KEGG   Pseudoxanthomonas suwonensis: Psesu_0507Help
Entry
Psesu_0507        CDS       T01403                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psesu_0507
Enzymes [BR:psu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Psesu_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(560816..561781)
Genome map
AA seq 321 aa AA seqDB search
MNPVIVVGSFNVDHVWRCNELPATGATIAGQYMTGPGGKGFNQAVACARAGAPTTFICAL
GDDPGGALARELAESDGIDLRAEASSEPTGTAGIYVDARGRNSIVIGAGANGVLSAGHVT
ADRALAGEAGVLLAQLESPVEAIEAALQMAREAGTTTLLNPAPANAPTSMGLLRLADVLT
PNETEFAAQLSRHVGERIEPDAVAALDGARLHALCRKLLPHGTVVVTMGSVGVFVSHAEE
EPRGDGQPYYRIGAESVTASDTTGAGDAFNGALAASLARAPGQPFATHVRYANRFAALST
ERAGAAASMPRHDEVLARFPG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaatccggtcatcgtcgtcggctccttcaacgtcgaccatgtctggcgttgcaatgaa
ctccccgccactggcgccaccatcgccggccagtacatgaccggtcccggcggcaagggt
ttcaaccaggccgtggcttgcgcccgcgccggcgcgcccaccaccttcatctgcgcactc
ggcgacgaccccggtggcgcactcgcccgcgaactggcggaatccgacggcatcgacctg
cgcgcggaagccagcagcgagcccaccggcaccgccggcatctatgtcgacgcccgtggc
cgcaacagcatcgtgatcggcgccggcgccaacggcgtgctcagcgccggccacgtcacc
gccgaccgggcgttggccggcgaggccggcgtgctgctcgcccagctggagtcgccggtg
gaggcgatcgaggccgcgctgcagatggcgcgcgaggccggcaccaccaccctgctcaac
ccggcgccggccaatgcgccgaccagcatgggcctgctgcgcctggccgacgtgctgacc
ccgaacgagaccgagttcgccgcccagctgtcgcgccacgtcggcgagcggatcgaaccg
gacgcggtcgccgcgctggacggcgcgcgcctgcacgcgctgtgccgcaagctcctgccg
cacggcaccgtggtggtgaccatgggctcggtaggcgtgttcgtctcgcatgccgaggaa
gagccgcgcggcgacggccagccctactaccgcatcggcgccgagagcgtgaccgccagc
gacaccaccggcgccggcgatgccttcaacggtgcgcttgccgcctcgctggcgcgcgcg
ccagggcagccgttcgcgacccacgtgcgctatgccaaccgtttcgccgcgctgtcgacc
gagcgcgccggcgcggccgcctcgatgccgcgccacgacgaggtactggcccgcttcccg
ggctga

DBGET integrated database retrieval system