KEGG   Pseudoxanthomonas suwonensis: Psesu_0536Help
Entry
Psesu_0536        CDS       T01403                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:psu00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
593133..593753
Genome map
AA seq 206 aa AA seqDB search
MRGTLFIVAAPSGAGKSSIVNAVLSRDTSIRLSVSFTSRGPRPGERHAEHYHFVSAEEFQ
RMIAAGDFFEYARVHGDWKGTARQSVEPQLAAGHDVLLEIDWQGAAQVRAKVPDAVSVFI
LPPSREALEQRMRKRGQDSDEVIAQRMAAAREEMSHYGEFDYVIVNEVFETAVDEMCAIF
VASRLRRGQQQQRHAGLIRGLLDQHG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaggggcacccttttcatcgtggcggcgccgtcgggggcggggaagtcgagcatcgtc
aacgcggtgctctcgcgcgacacgtcgatccgcctgtcggtctcgttcacctcgcgcggg
ccgcgtccgggggagcggcatgccgagcactaccacttcgtctccgcggaggagttccag
cggatgatcgcggccggcgacttcttcgagtacgcccgcgtgcacggcgactggaagggc
acggcgcggcagtcggtggagccgcaactggccgccggccacgacgtgctgctggagatc
gactggcagggcgcggcccaggtgcgggccaaggtgccggacgcggtgagcgtgttcatc
ctgccgccgtcgcgcgaggcgctggagcagcgcatgcgcaagcgcggccaggacagcgac
gaggtcatcgcccagcgcatggccgccgcgcgcgaggagatgtcgcactacggtgagttc
gactacgtcatcgtcaacgaggtgttcgagaccgcggtggacgagatgtgcgcgatcttc
gtcgccagccgcctgcgccgcggccagcagcagcagcgccatgccggcctgatccgcggc
ctgctggaccagcacggctga

DBGET integrated database retrieval system