KEGG   Pseudoxanthomonas suwonensis: Psesu_0591Help
Entry
Psesu_0591        CDS       T01403                                 

Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Psesu_0591
Enzymes [BR:psu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Psesu_0591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
657614..658204
Genome map
AA seq 196 aa AA seqDB search
MIGRLRGTLVLKQPPWLVVDVNGVGYELEAPMSTFYDLPELGREVSLFTHYAQKEDSVSL
YGFLRESERRLFRDVQKVSGIGAKIALAVLSGVSVDEFARLVQAGDVTALTRIPGIGKKT
AERMVVELRDRAADLAGGGAVAGMTAAPGDPMADAATALQQLGYKPADAQRMARDAAAPG
DEAAAIIRKALQSALR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgattggaagactgcgcggaaccctggtgctgaagcagccgccgtggctggtggtcgac
gtcaacggcgtcggttacgagctggaggcgccgatgagcaccttctatgacctgccggag
ctgggacgcgaggtctcgctgttcacccattacgcgcagaaggaggacagcgtctcgctg
tacggcttcctgcgcgagagcgagcggcggctgttccgcgacgtgcagaaggtcagcggc
atcggcgcgaagatcgcgctggcggtgctgtccggggtgagcgtggacgagttcgcgcgc
ctggtgcaggccggcgacgtcaccgcgctgacccggatcccgggcatcggcaagaagacc
gccgagcgcatggtggtggagctgcgcgaccgcgccgccgacctcgccggcggcggcgca
gtggccgggatgaccgcggcgccgggcgatcccatggccgacgccgccaccgccctgcag
cagctcggctacaagccggccgatgcgcagcgcatggcccgcgacgccgccgcccccggc
gacgaggccgcggccatcatccgcaaggccctgcagtccgccctgcgctga

DBGET integrated database retrieval system