KEGG   Pseudoxanthomonas suwonensis: Psesu_0635Help
Entry
Psesu_0635        CDS       T01403                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:psu00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:psu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
709741..711228
Genome map
AA seq 495 aa AA seqDB search
MSRSMPLSRLLPDVALPRDIAVSGLVMDSREVKPGDAFVAIAGFGTHGLAFAEQARQAGA
VAILFEPPAPAEYPAPADAIAVPGLRSRLGAMADLFHGHPSHAMTMVGVTGTNGKTSTVQ
LLAQAWHLRGLRGGSIGTLGAGLHGEVRPTGFTTPLVLSMHALLGGLRDAGAEAVAMEVS
SHALDQGRVDGVHYDVAVFTNLTRDHLDYHGDMASYGEAKARLFLREGLRSAVLNLDDEF
GRVLAGRLAEGVRLVGVSSRGQEGAALQARGLQFDARGIAFELSDGVESHPVRSPLLGRF
NVDNLLAVGGVLHALGDSVACVAAILSRLQPVAGRMNRLGGDGERPLVVVDYAHTPDALE
QALASLRAHAGARLTCVFGCGGERDRGKRPMMARIAEQHADRVVVTDDNPRGEDGDAIVA
GIMAGFAAPEAVQVERDRALAIARAIARSGAQDVVLVAGKGHEPYQEIAGVRHPFDDTEV
ARAALDAWTATEVQA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctcgatgccgctttcccgcctgctgcccgacgtcgcgctgccgcgcgacatc
gccgtttccgggctggtgatggattcccgcgaggtgaagccgggcgatgccttcgtggcc
atcgccgggttcggcacccatggcctggccttcgccgagcaggcgcgccaggccggcgcc
gtggcgatcctgttcgaaccgccggccccggccgagtacccggcgccggcggacgccatc
gccgtgcccgggttgcgttcgcgcctgggcgcgatggccgacctgttccacggccatccc
tcgcacgcgatgacgatggttggcgtcaccggcaccaacggcaagacctcgaccgtgcag
ctgctggcccaggcctggcacctgcgcggactgcgcggcggcagcatcggcacgctcggc
gccggcctgcacggcgaggtgcgcccgaccggtttcaccaccccgctggtgctgagcatg
catgcgctgctgggcgggctgcgcgacgccggcgccgaggcggtggcgatggaagtcagc
tcgcacgccctggaccagggccgggtcgacggcgtgcactacgacgtggcggtgttcacc
aacctcacccgcgaccacctcgactaccacggcgacatggccagctacggcgaggccaag
gccaggctgttcctgcgcgaggggctccgctccgcggtgctgaacctggatgacgaattc
ggccgcgtactggccgggcgcctggcggaaggcgtgcgcctggtcggggtcagctcgcgc
ggccaggaaggcgccgccctgcaggcgcgcgggctgcagttcgacgcgcgcggcatcgcc
ttcgagctgtccgatggggtcgaatcccatccggtgcgctcgccgctgctgggccgtttc
aatgtcgacaacctgctggcggtgggcggcgtgctgcatgcgctgggcgacagcgtggcc
tgcgtggccgcgatcctgtcgcgcctgcagccggtggccgggcgcatgaaccgcctcggc
ggcgacggcgagcgcccgctggtggtggtcgactacgcccataccccggacgcgctggag
caggcgctggccagcctgcgcgcccatgccggcgcgcgcctgacctgcgtgttcggctgc
ggcggcgagcgcgaccgcggcaagcgcccgatgatggcgcgcatcgccgagcagcatgcc
gaccgggtcgtggtcaccgacgacaacccgcgtggcgaggatggcgatgccatcgtcgcc
gggatcatggccggcttcgccgcgcccgaagcggtgcaggtggagcgcgaccgtgcgctg
gccatcgcccgcgccatcgcccgctccggcgcgcaggacgtggtcctggtcgccggcaag
ggccacgagccttaccaggagatcgccggcgtgcggcatcccttcgacgacaccgaggtg
gcacgtgccgccctggatgcgtggaccgcgacggaggtgcaggcatga

DBGET integrated database retrieval system