KEGG   Pseudoxanthomonas suwonensis: Psesu_0649Help
Entry
Psesu_0649        CDS       T01403                                 

Definition
preprotein translocase subunit SecA
Orthology
K03070  
preprotein translocase subunit SecA
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:psu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Psesu_0649
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Psesu_0649
Secretion system [BR:psu02044]
 Sec (secretion) system
  Bacterial Sec-SRP protein [MD:M00335]
   Psesu_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
725380..728118
Genome map
AA seq 912 aa AA seqDB search
MINKLLTRVFGSRNERLLRQLDRIVARINALEPEMQKLSDEELKARTPEFQKRIADGESL
DKILPEAFAVCREASNRVLGMRHYDVQLIGGMVLHMGKIAEMRTGEGKTLVGTLPVYLNA
LEGKGVHVITVNDYLARRDAAWMGRLYNWLGLSVGVVYPGMPHADKKEAYAADITYGTNN
EFGFDYLRDNMALSKSDRFQRGLHYAIVDEVDSILIDEARTPLIISGPADESPELYIRVN
RIVPQLKRQEVEDGIGDYWVDEKGKQVHLSEAGMEHAEELLRRAGILGEDESLYGANNLS
VVHHLNAALRAHALFQRDVDYIVRDGEVVIVDEFTGRTLAGRRWSDGLHQAVEAKEGVPV
QRENQTLASITFQNLFRMYRKLSGMTGTADTEAYEFQSIYGLEVVVIPTHRPIQRVDHPD
QVFLNREGKFRAVLADIQDCHKRGQPVLVGTTSIETSEMLSNFLRESGVAHEVLNAKQHE
REAQIVAHAGRPGAVTIATNMAGRGTDIVLGGSLESELQELGEEAGDAEKERVRAAWRER
HEAVKAAGGLHIIGTERHESRRIDNQLRGRSGRQGDPGSSRFYLSLEDNLMRIFASDWVQ
KAMRMMGMKEDDVIEDRLVTRQIEKAQRKVEAHNFDIRKNLLDFDDVNNDQRKVIYAQRD
ELLEAESVKENIDGILGDVVNELVTRFVPPESVDEQWDLPGLEVALESELGLRLDLQGLS
KASEELDAEGIERHVQEAAVALFEEKEKQLGGETMRALEKHIMLTVLDQSWKEHLARMDY
LRQGIHLRGYAQKQPKQEYKKEAFELFSEMLDNVKRQVISLLARVRIRSEEEVAALEAQE
RAQAEAKLRAAQFQHADNGGYGTEDEVAGIIGAQAPAGPAPSIVREEPKVGRNDPCPCGS
GKKYKHCHGQLG
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacaaactgctcacccgtgtcttcggcagccgcaacgaacggctcctgcgccag
ctggaccgcatcgtcgccaggatcaacgccctggaaccggagatgcagaagctctccgac
gaagagctgaaggccaggacgccggagttccagaagcggatcgccgacggtgagtcgctg
gacaagatcctgccggaggccttcgcggtctgccgcgaggccagcaaccgcgtgctgggc
atgcgccactacgacgtgcagctgatcggcggcatggtcctgcacatgggcaagatcgcc
gagatgcgcaccggcgagggcaagaccctggtcggcaccctgccggtgtacctcaacgcc
ctggaaggcaagggcgtgcacgtgatcaccgtcaacgactacctggcccgccgcgacgcg
gcctggatgggcaggctctacaactggctgggcctgagcgtgggcgtggtctacccgggc
atgccgcacgccgacaagaaggaggcctacgcggccgacatcacctacggcaccaacaac
gagttcggcttcgactacctgcgcgacaacatggcgctgtcgaagtccgaccgcttccag
cgcggcctgcactacgcgatcgtcgacgaggtcgattcgatcctgatcgacgaggcgcgc
actccgctgatcatctccggcccggccgacgagtcgccggagctgtacatccgggtcaac
cggatcgtgccgcagctcaagcgccaggaagtcgaggacggcatcggcgactactgggtc
gacgagaagggcaagcaggtgcacctgtccgaggcgggcatggagcacgccgaagaactg
ctgcgccgcgccggcatcctcggcgaggacgagagcctgtacggcgccaacaacctgtcg
gtcgtgcaccacctcaatgccgccctgcgtgcgcacgcgctgttccagcgcgacgtggac
tacatcgtccgcgacggcgaggtggtgatcgtcgacgagttcaccggccgcaccctggct
ggccgccgctggtccgacggcctgcaccaggcggtcgaggcgaaggaaggtgtgccggtc
cagcgcgagaaccagaccctggccagcatcaccttccagaacctgttccgcatgtacagg
aagctgtccggcatgaccggtacggctgacaccgaggcctacgagttccagagcatctac
ggcctggaagtggtggtgatcccgacccaccggccgatccagcgcgtggaccatccggac
caggtgttcctcaaccgcgagggcaagttccgcgcggtgctggccgacatccaggactgc
cacaagcgcggccagccggtgctggtgggcacgacctcgatcgagacctcggagatgctg
tccaacttcctgcgcgagtcgggagttgcgcacgaggtgctcaacgccaagcagcacgag
cgcgaggcgcagatcgtcgcccacgccggtcgtccgggtgcggtgaccatcgccaccaac
atggccggccgcggtaccgacatcgtgctgggcggctcgctggagtccgagctgcaggaa
ctgggcgaggaagccggcgacgccgagaaggagcgggtgcgtgccgcgtggcgcgagcgc
cacgaggcggtcaaggccgccgggggcctgcacatcatcggcaccgagcggcacgagagc
cgccgcatcgacaaccagctgcgtggccgttccggccgccagggcgacccgggctcgtcc
cgcttctacctgtcgctggaagacaacctcatgcgcatcttcgcctccgactgggtgcag
aaggcgatgcgcatgatgggcatgaaggaagacgacgtcatcgaggaccggctggttacc
cgccagatcgagaaggcgcagcgcaaggtcgaggcccacaacttcgacatccgcaagaac
ctgctggacttcgacgacgtcaacaacgaccagcgcaaggtgatctacgcccagcgcgac
gagctgctggaagccgagtcggtcaaggagaacatcgacggcatcctcggcgacgtggtc
aacgaactggtcacccgcttcgtcccgccggagtcggtggacgagcagtgggacctgccg
ggcctggaggtcgcgctggaatccgagctgggcctgcgcctggacctgcagggcctgtcc
aaggccagcgaggagctggatgccgagggcatcgagcgccacgtgcaggaggcggcggtc
gccctgttcgaggagaaggagaagcagctcggcggggagaccatgcgcgcgctggagaag
cacatcatgctgaccgtgctcgaccagagctggaaggaacacctggcgcgcatggactac
ctgcgccagggcatccacctgcgcggctatgcgcagaagcagccgaagcaggagtacaag
aaggaagccttcgagctgttctcggagatgctggacaacgtcaagcgccaggtgatcagc
ctgctggcgcgggtccgcatccgcagcgaggaggaggtcgccgcgctggaagcccaggag
cgtgcccaggccgaggccaagctgcgcgcggcgcagttccagcacgccgacaacggcggg
tacggcaccgaggacgaggtcgccggcatcatcggcgcccaggctccggccggcccggcg
cccagcatcgtgcgcgaggagccgaaggtcggccgcaacgatccctgcccctgcggcagc
ggcaagaagtacaagcactgccacggccagctcggctga

DBGET integrated database retrieval system