KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_0649Help
Entry
Psesu_0649        CDS       T01403                                 

Definition
(GenBank) preprotein translocase, SecA subunit
  KO
K03070  
preprotein translocase subunit SecA
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:psu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Psesu_0649
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Psesu_0649
Secretion system [BR:psu02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   Psesu_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
725380..728118
Genome map
AA seq 912 aa AA seqDB search
MINKLLTRVFGSRNERLLRQLDRIVARINALEPEMQKLSDEELKARTPEFQKRIADGESL
DKILPEAFAVCREASNRVLGMRHYDVQLIGGMVLHMGKIAEMRTGEGKTLVGTLPVYLNA
LEGKGVHVITVNDYLARRDAAWMGRLYNWLGLSVGVVYPGMPHADKKEAYAADITYGTNN
EFGFDYLRDNMALSKSDRFQRGLHYAIVDEVDSILIDEARTPLIISGPADESPELYIRVN
RIVPQLKRQEVEDGIGDYWVDEKGKQVHLSEAGMEHAEELLRRAGILGEDESLYGANNLS
VVHHLNAALRAHALFQRDVDYIVRDGEVVIVDEFTGRTLAGRRWSDGLHQAVEAKEGVPV
QRENQTLASITFQNLFRMYRKLSGMTGTADTEAYEFQSIYGLEVVVIPTHRPIQRVDHPD
QVFLNREGKFRAVLADIQDCHKRGQPVLVGTTSIETSEMLSNFLRESGVAHEVLNAKQHE
REAQIVAHAGRPGAVTIATNMAGRGTDIVLGGSLESELQELGEEAGDAEKERVRAAWRER
HEAVKAAGGLHIIGTERHESRRIDNQLRGRSGRQGDPGSSRFYLSLEDNLMRIFASDWVQ
KAMRMMGMKEDDVIEDRLVTRQIEKAQRKVEAHNFDIRKNLLDFDDVNNDQRKVIYAQRD
ELLEAESVKENIDGILGDVVNELVTRFVPPESVDEQWDLPGLEVALESELGLRLDLQGLS
KASEELDAEGIERHVQEAAVALFEEKEKQLGGETMRALEKHIMLTVLDQSWKEHLARMDY
LRQGIHLRGYAQKQPKQEYKKEAFELFSEMLDNVKRQVISLLARVRIRSEEEVAALEAQE
RAQAEAKLRAAQFQHADNGGYGTEDEVAGIIGAQAPAGPAPSIVREEPKVGRNDPCPCGS
GKKYKHCHGQLG
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacaaactgctcacccgtgtcttcggcagccgcaacgaacggctcctgcgccag
ctggaccgcatcgtcgccaggatcaacgccctggaaccggagatgcagaagctctccgac
gaagagctgaaggccaggacgccggagttccagaagcggatcgccgacggtgagtcgctg
gacaagatcctgccggaggccttcgcggtctgccgcgaggccagcaaccgcgtgctgggc
atgcgccactacgacgtgcagctgatcggcggcatggtcctgcacatgggcaagatcgcc
gagatgcgcaccggcgagggcaagaccctggtcggcaccctgccggtgtacctcaacgcc
ctggaaggcaagggcgtgcacgtgatcaccgtcaacgactacctggcccgccgcgacgcg
gcctggatgggcaggctctacaactggctgggcctgagcgtgggcgtggtctacccgggc
atgccgcacgccgacaagaaggaggcctacgcggccgacatcacctacggcaccaacaac
gagttcggcttcgactacctgcgcgacaacatggcgctgtcgaagtccgaccgcttccag
cgcggcctgcactacgcgatcgtcgacgaggtcgattcgatcctgatcgacgaggcgcgc
actccgctgatcatctccggcccggccgacgagtcgccggagctgtacatccgggtcaac
cggatcgtgccgcagctcaagcgccaggaagtcgaggacggcatcggcgactactgggtc
gacgagaagggcaagcaggtgcacctgtccgaggcgggcatggagcacgccgaagaactg
ctgcgccgcgccggcatcctcggcgaggacgagagcctgtacggcgccaacaacctgtcg
gtcgtgcaccacctcaatgccgccctgcgtgcgcacgcgctgttccagcgcgacgtggac
tacatcgtccgcgacggcgaggtggtgatcgtcgacgagttcaccggccgcaccctggct
ggccgccgctggtccgacggcctgcaccaggcggtcgaggcgaaggaaggtgtgccggtc
cagcgcgagaaccagaccctggccagcatcaccttccagaacctgttccgcatgtacagg
aagctgtccggcatgaccggtacggctgacaccgaggcctacgagttccagagcatctac
ggcctggaagtggtggtgatcccgacccaccggccgatccagcgcgtggaccatccggac
caggtgttcctcaaccgcgagggcaagttccgcgcggtgctggccgacatccaggactgc
cacaagcgcggccagccggtgctggtgggcacgacctcgatcgagacctcggagatgctg
tccaacttcctgcgcgagtcgggagttgcgcacgaggtgctcaacgccaagcagcacgag
cgcgaggcgcagatcgtcgcccacgccggtcgtccgggtgcggtgaccatcgccaccaac
atggccggccgcggtaccgacatcgtgctgggcggctcgctggagtccgagctgcaggaa
ctgggcgaggaagccggcgacgccgagaaggagcgggtgcgtgccgcgtggcgcgagcgc
cacgaggcggtcaaggccgccgggggcctgcacatcatcggcaccgagcggcacgagagc
cgccgcatcgacaaccagctgcgtggccgttccggccgccagggcgacccgggctcgtcc
cgcttctacctgtcgctggaagacaacctcatgcgcatcttcgcctccgactgggtgcag
aaggcgatgcgcatgatgggcatgaaggaagacgacgtcatcgaggaccggctggttacc
cgccagatcgagaaggcgcagcgcaaggtcgaggcccacaacttcgacatccgcaagaac
ctgctggacttcgacgacgtcaacaacgaccagcgcaaggtgatctacgcccagcgcgac
gagctgctggaagccgagtcggtcaaggagaacatcgacggcatcctcggcgacgtggtc
aacgaactggtcacccgcttcgtcccgccggagtcggtggacgagcagtgggacctgccg
ggcctggaggtcgcgctggaatccgagctgggcctgcgcctggacctgcagggcctgtcc
aaggccagcgaggagctggatgccgagggcatcgagcgccacgtgcaggaggcggcggtc
gccctgttcgaggagaaggagaagcagctcggcggggagaccatgcgcgcgctggagaag
cacatcatgctgaccgtgctcgaccagagctggaaggaacacctggcgcgcatggactac
ctgcgccagggcatccacctgcgcggctatgcgcagaagcagccgaagcaggagtacaag
aaggaagccttcgagctgttctcggagatgctggacaacgtcaagcgccaggtgatcagc
ctgctggcgcgggtccgcatccgcagcgaggaggaggtcgccgcgctggaagcccaggag
cgtgcccaggccgaggccaagctgcgcgcggcgcagttccagcacgccgacaacggcggg
tacggcaccgaggacgaggtcgccggcatcatcggcgcccaggctccggccggcccggcg
cccagcatcgtgcgcgaggagccgaaggtcggccgcaacgatccctgcccctgcggcagc
ggcaagaagtacaagcactgccacggccagctcggctga

DBGET integrated database retrieval system