KEGG   Pseudoxanthomonas suwonensis: Psesu_0737Help
Entry
Psesu_0737        CDS       T01403                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Psesu_0737
Enzymes [BR:psu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Psesu_0737
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Psesu_0737
Lipid biosynthesis proteins [BR:psu01004]
 Fatty acid synthase
  Component type
   Psesu_0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
826179..826772
Genome map
AA seq 197 aa AA seqDB search
MLLSGSLLAAPPARAKGPVLVLGDSLSAEHNIPRGSGWVSLLERKLRSEPPLSRGVVNAS
ISGETSAGALTRLPALLEKHKPSVLVIELGGNDALRGLAPAQLEANLRRMVERGRASGAR
VLLLGIDVPPNYGPAYRERLRRTYASLAEGKDVALVPFFLEGVALEPGLMQGDGLHPTAA
AQPRLLDNVWPALRPLL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctgtcaggttcgctgctggcggcgcccccggcccgtgccaaaggtccggtgctg
gtactcggcgacagcctgagcgcggaacacaacatacccagaggctccggctgggtcagc
ctgctggagcggaaactccgttccgagcccccgctgtcccgtggcgtggtcaatgccagc
atcagtggcgagaccagtgccggcgcccttacccggctgccggcgctgctggagaagcac
aagccgtcggtgctggtgatcgagctgggcggcaatgacgccctgcgcgggcttgccccg
gcccagctcgaggccaacctgcggcgcatggtcgagcggggcagggcctcgggtgcccgg
gtgctgctgctgggcatcgacgtgccgcccaactacggcccggcgtaccgcgagcgcctg
cgccgcacctacgccagcctggccgagggcaaggacgtggccctggtgccattcttcctc
gagggcgtggccctggagccgggcctgatgcagggcgacggcctccatcccaccgcggcc
gcccagccgcgcctgctggacaacgtctggccagccctgcgccccctgctctga

DBGET integrated database retrieval system