KEGG   Pseudoxanthomonas suwonensis: Psesu_0737Help
Entry
Psesu_0737        CDS       T01403                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:psu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
826179..826772
Genome map
AA seq 197 aa AA seqDB search
MLLSGSLLAAPPARAKGPVLVLGDSLSAEHNIPRGSGWVSLLERKLRSEPPLSRGVVNAS
ISGETSAGALTRLPALLEKHKPSVLVIELGGNDALRGLAPAQLEANLRRMVERGRASGAR
VLLLGIDVPPNYGPAYRERLRRTYASLAEGKDVALVPFFLEGVALEPGLMQGDGLHPTAA
AQPRLLDNVWPALRPLL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctgtcaggttcgctgctggcggcgcccccggcccgtgccaaaggtccggtgctg
gtactcggcgacagcctgagcgcggaacacaacatacccagaggctccggctgggtcagc
ctgctggagcggaaactccgttccgagcccccgctgtcccgtggcgtggtcaatgccagc
atcagtggcgagaccagtgccggcgcccttacccggctgccggcgctgctggagaagcac
aagccgtcggtgctggtgatcgagctgggcggcaatgacgccctgcgcgggcttgccccg
gcccagctcgaggccaacctgcggcgcatggtcgagcggggcagggcctcgggtgcccgg
gtgctgctgctgggcatcgacgtgccgcccaactacggcccggcgtaccgcgagcgcctg
cgccgcacctacgccagcctggccgagggcaaggacgtggccctggtgccattcttcctc
gagggcgtggccctggagccgggcctgatgcagggcgacggcctccatcccaccgcggcc
gcccagccgcgcctgctggacaacgtctggccagccctgcgccccctgctctga

DBGET integrated database retrieval system