KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_0793Help
Entry
Psesu_0793        CDS       T01403                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Brite
Enzymes [BR:psu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Psesu_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_11 Methyltransf_31 TehB Methyltransf_23 Methyltransf_32 ADH_zinc_N RrnaAD SAM_MT Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: ADV26646
JGI: Psesu_0793
UniProt: E6WQX4
Position
884996..885685
Genome map
AA seq 229 aa AA seqDB search
MTPRLRLQPEVVGVGMTSQRVRDRLVQRLREGGANGGIVDENVLNAVRLVPRHLFVDEAL
ASRAYEDTALPIGHGQTISQPWVVARMTEAVLAVQPKKVLEIGTGSGYQAAILAALGLEV
YTVERIGELLRQARKRFRTLGMNIRSKHDDGRIGWPEHGPYDAIVVTAAAPALVEALLDQ
LAVGGMLVAPVGGASAQSLLQLVRQPDGSIQEQTLAPVVFVPLLAGTLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgcgcctgcgcctgcagccggaggtggtcggcgtcggcatgacctcgcagcgc
gtgcgcgaccgcctggtccagcgcctgcgcgagggtggcgccaacggcggcatcgtcgac
gagaacgtgctcaacgccgtgcgcctggtgccgcgccacctgttcgtggacgaggccctg
gccagccgtgcctacgaggacaccgcgctgccgatcggccatggccagaccatctcccag
ccctgggtggtggcgcgcatgaccgaggcggtgctggcggtgcagccgaagaaggtgctg
gagatcggcaccggctccggctaccaggcggcgatcctcgccgcgctggggctggaggtg
tacaccgtcgagcgcatcggcgagctgctgcggcaggcgcgcaagcgcttccgcacgctg
ggcatgaacatccgcagcaagcacgacgacggccgcatcggctggcccgagcatggcccg
tacgacgccatcgtggtcaccgccgccgccccggccctggtcgaggcgctgctggaccag
ctggccgtcggcggcatgctggtcgccccggtcggcggcgcctccgcgcagtcgctgctg
cagctggtcaggcagcccgacggctccatccaagaacagacgctggcgccggtggtgttc
gtgcccctgctggcaggaaccctggactga

DBGET integrated database retrieval system