KEGG   Pseudoxanthomonas suwonensis: Psesu_0898Help
Entry
Psesu_0898        CDS       T01403                                 

Definition
tRNA pseudouridine synthase D TruD
Orthology
K06176  
tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
psu  Pseudoxanthomonas suwonensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1005440..1006498
Genome map
AA seq 352 aa AA seqDB search
MQAFGAPVLAARIRSVPEDFRVEELDGFEASGDGEHLLLTIEKRGMNTAFVAGELARWAG
VPEVAVGYAGLKDRHAVTVQRFSVQLPGREAPPLETLERDGLRVLAQARHKRKLPRGALA
GNRFVLVLRGVQGERDAVEARLQEIAARGVPNAFGGQRFGHEGGNIAKALAMFGGKRVGR
EQRSMLLSAARSALFNQVLAARVADGSWDRGLDGEVWALEGSRSVFGPEPMSGQIAERLA
AFDIHPSGPLWGRGSLRSEGACQALELEAIADPVSLRLRDGLERAGLDQERRALRLRPQD
LAWRWLEAGVLELAFSLPSGCYATSVLEQLGTIEDAAARPATPGDEAAPEKP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgttcggcgcgccggtactggcggcgcggatccgcagcgtgcccgaggatttc
cgggtcgaggagctggatggcttcgaagccagcggcgacggcgaacacctgctgctgacc
atcgagaagcgaggcatgaacaccgccttcgtcgccggcgagctggcgcgctgggcgggg
gtgccggaggtggcggtgggctatgccggcctcaaggaccgccatgcggtgaccgtgcaa
cgcttcagcgtgcagctgccggggcgcgaggcgccgccgctggagacgctggagcgcgac
ggcctgcgcgtgctggcccaggcccggcacaagcgcaagctgccgcgcggtgcgctggcc
ggcaaccgcttcgtgctggtgctgcgcggcgtgcagggcgagcgcgatgccgtcgaggcg
cggctgcaggagattgccgcccgtggcgtacccaacgcgttcggcggacagcgcttcgga
cacgagggcggcaatatcgccaaggcgctggcgatgttcggcggcaagcgggtggggcgc
gagcagcgctcgatgctgctgtcggcggcgcgttcggcactgttcaaccaggtcctggcc
gcgcgcgtggccgatggcagctgggaccgtggcctggacggcgaggtctgggcgctggag
ggcagccgcagcgtgttcggcccggagccgatgagcgggcagatcgccgagcgcctggcc
gcgttcgacatccatcccagcggcccgttgtggggccgcggcagcctgcgcagcgagggg
gcctgccaggcgcttgagctggaggcgatcgcggacccggtctcgctgcggctgcgcgac
gggctcgagcgcgccggcctggaccaggagcgccgcgctctgcgcctgcgcccgcaggac
ctggcctggcgctggctggaggccggcgtgctggagctggcgttctcgctgccgtccggc
tgctatgccacctcggtgctggaacagctgggcacgatcgaggacgcggcggcgcgtccg
gccacgccgggtgacgaggctgcgccggagaagccctga

DBGET integrated database retrieval system