KEGG   Pseudoxanthomonas suwonensis: Psesu_0916Help
Entry
Psesu_0916        CDS       T01403                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:psu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1028566..1030260
Genome map
AA seq 564 aa AA seqDB search
MCSIFGIFGLQPGDDLQDLRRQSLDLSQRQRHRGPDWSGVYVDAGAILVHERLAIVDPAG
GSQPLLSEDGGLALAVNGEIYNHKLLKDGLRQPYAFQTASDCEVINALYREDEPASFLNR
LNGIFAFALWDKAKGRAIIARDPIGVVPLYWGHDREGRLRVASEMKSLVEECADVAQFPP
GHWYDTATGELTKYYERPWRDYDAVEGVEVTPQELREAFEAAVHRQLMTDVPYGVLLSGG
LDSSLVAAVAARYARHRVEDGDQTEAWWPRLHSFAIGLEGSPDLAAAKVAAEALGTVHHG
FEYTFEEGLDALPEVIRHIETYDVTTIRASTPMFLLARRIKAMGVKMVLSGEGSDEVFGG
YLYFHKAPNAREFHEELVRKLDALNFYDCLRANKSMMAWGVEPRVPFLDREFLDVAMRMD
AKYKMVLKGSDGPQRMEKGILRQAFDGYLPPEILWRQKEQFSDGVGYGWIDGLKAHAEAQ
VSDRELAAADKRFPVNPPQTKEAYFYRTLFERFFPGQAAAETVPGGKSIACSSPAAIAWD
ASFAKMADPSGRAVAGVHNEALAG
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgatcttcggcatcttcggcctgcaaccgggcgatgacctgcaggaccttcgc
cggcagtcgctggacctgtcgcagcgccagcgccaccgcggccccgactggagcggcgtg
tacgtggacgcgggcgcgatcctggtgcacgagcgcctggccatcgtcgatccggccggc
ggctcgcagccgctgctgtccgaggacggcgggctggcgctggcggtcaatggcgagatc
tacaaccacaagctgctgaaggacgggctgcggcagccgtacgcgttccagaccgcgtcg
gactgcgaggtgatcaacgcgctgtaccgcgaggacgagccggcctcgttcctcaaccgg
ctcaacggcatcttcgctttcgccctgtgggacaaggcgaaggggcgcgcgatcatcgcc
cgcgatccgatcggcgtggtgccgctgtactggggccatgaccgcgaaggccgcctgcgc
gtggcctcggagatgaagtcgctggtggaggagtgcgccgacgtcgcccagttcccgccc
ggccactggtacgacaccgccaccggcgaactcacgaagtactacgagcggccgtggcgc
gactacgacgcggtcgagggcgtggaagtcacgcctcaggaactgcgcgaggcgttcgag
gcggcggtgcaccgccagctgatgaccgacgtgccctacggcgtgctgctgtccggcggc
ctggattcgtcgctggtcgcggcggtggccgcgcgttacgcccgccatcgcgtcgaggat
ggcgaccagaccgaggcctggtggccgcgcctgcactcgttcgccatcggcctggagggt
tcgcccgacctggcagcggccaaggttgccgccgaggcgctgggcaccgtgcaccacggc
ttcgaatacaccttcgaggaaggcctggacgcgctgccggaggtgatccgccacatcgag
acctatgacgtcaccaccatccgcgcctccacgccgatgttcctgctcgcgcgccggatc
aaggccatgggagtgaagatggtgctgtcgggcgaaggcagcgacgaggtgttcggcggt
tacctgtacttccacaaggcaccgaacgcgcgcgagttccacgaggagctggtgcgcaag
ctcgacgcgctcaacttctatgactgcctgcgtgccaacaagtcgatgatggcctggggc
gtggagccgcgcgttccgttcctggaccgcgagttcctcgacgtggccatgcgcatggac
gccaagtacaagatggtgctcaagggcagcgacggcccgcagcggatggagaagggcatc
ctgcgccaggccttcgacggctacctgccgccggagatcctgtggcggcagaaggagcag
ttcagcgacggcgtcggctacggctggatcgacggcctcaaggcgcatgccgaggcccag
gtctccgaccgcgagctggccgccgccgacaagcgcttcccggtcaacccgccgcagacc
aaggaggcgtacttctaccgcaccctcttcgagcgcttctttccgggccaggccgcggcg
gaaacggtgccgggcggcaagtcgatcgcctgttcctcgcccgcggcgatcgcctgggac
gccagcttcgcgaagatggccgacccatccggtcgcgcggtggcaggcgtgcacaacgag
gcgctggcggggtga

DBGET integrated database retrieval system