KEGG   Pseudoxanthomonas suwonensis: Psesu_1072Help
Entry
Psesu_1072        CDS       T01403                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:psu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:psu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1211856..1213139
Genome map
AA seq 427 aa AA seqDB search
MQKIVVSGGVPLRGEVAISGAKNAVLPILCATLLADAPVEIVNVPDLHDVRTTLKLLGEL
GASVRYVDGELARSLVVDPCTVSQHVAPYDLVKTMRASILVLGPLLARHGAAEVALPGGC
AIGSRPVDQHIRGLQALGAEINVENGYIKARAGRLKGARFVFDMVTVTGTENVMAAATLA
EGTTVLENAAMEPEVVDLADCLNALGARIEGAGTSRITIHGVERLGGGRHVVLPDRIETG
TFLVAAAMTGGRVTTLNARPDTLEAVLDKLREAGATVTTTADSITVDMEGRRPRAVGLTT
APYPAFPTDMQAQFMALNCVAEGVGVISETIFENRFMHVNELLRLGADIQIDGHTAVVRG
VQRLSGAPVMATDLRASASLILAGLVAEGETTIDRIYHLDRGYENIEAKLGALGASIRRI
DDRAGAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagatcgtagtcagcggcggcgtgccgctccgtggcgaagtcgccatctccggc
gccaagaacgccgtgctccccatcctgtgcgcgaccctgctggccgacgcgccggtggag
atcgtcaacgtccccgacctgcatgacgtgcgcaccacgctcaagctgctgggcgagctc
ggcgcgagcgtgcggtacgtcgacggcgagctggcgcgcagcctggtggtcgatccgtgc
accgtttcccagcacgtggcgccctacgacctggtcaagaccatgcgcgcctcgatcctg
gtgctgggcccgctgctggcgcgccacggcgcggccgaagtggccctgcccggcggctgc
gcgatcggctcgcgcccggtggaccagcacatccgcggcctgcaggcgctgggcgccgag
atcaacgtcgagaacggctacatcaaggcccgcgccgggcgcctgaagggcgcgcgcttc
gtgttcgacatggtgaccgtcaccggcaccgagaacgtcatggccgccgccaccctcgcc
gaaggcaccacggtgctcgagaacgcggcgatggagccggaggtggtcgacctggccgac
tgcctcaacgcgctgggcgcgcggatcgagggcgcgggcacctcgcgcatcaccatccac
ggcgtcgagcgcctcggcggcggccgccatgtggtcctgccggaccgcatcgagaccggc
accttcctggtggccgcggcgatgaccggcggccgcgtgaccacgctcaacgcgcgtccg
gacaccctggaagcagtgctggacaagctcagggaagctggcgccacggtcaccaccacc
gccgacagcatcaccgtggacatggaaggccggcgtccgcgcgcggtcggcctgaccacc
gcgccgtacccggcgttcccgaccgacatgcaggcgcagttcatggcgctcaactgcgtg
gccgagggcgtgggcgtgatcagcgagacgatcttcgaaaaccgcttcatgcacgtcaac
gagctgctgcgcctgggcgcggacatccagatcgacggccataccgcggtggtgcgtggc
gtgcagcgcctcagcggtgcgccggtgatggcgaccgacctgcgcgcctcggcctcgctg
atcctcgccggcctggtggccgagggcgagaccacgatcgaccgcatctaccacctggat
cgcggctacgagaacatcgaggccaagctcggcgcgctgggcgccagcatccgccgcatc
gacgaccgcgcgggagccgcctga

DBGET integrated database retrieval system