KEGG   Pseudoxanthomonas suwonensis: Psesu_1072Help
Entry
Psesu_1072        CDS       T01403                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Psesu_1072
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Psesu_1072
Enzymes [BR:psu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Psesu_1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1211856..1213139
Genome map
AA seq 427 aa AA seqDB search
MQKIVVSGGVPLRGEVAISGAKNAVLPILCATLLADAPVEIVNVPDLHDVRTTLKLLGEL
GASVRYVDGELARSLVVDPCTVSQHVAPYDLVKTMRASILVLGPLLARHGAAEVALPGGC
AIGSRPVDQHIRGLQALGAEINVENGYIKARAGRLKGARFVFDMVTVTGTENVMAAATLA
EGTTVLENAAMEPEVVDLADCLNALGARIEGAGTSRITIHGVERLGGGRHVVLPDRIETG
TFLVAAAMTGGRVTTLNARPDTLEAVLDKLREAGATVTTTADSITVDMEGRRPRAVGLTT
APYPAFPTDMQAQFMALNCVAEGVGVISETIFENRFMHVNELLRLGADIQIDGHTAVVRG
VQRLSGAPVMATDLRASASLILAGLVAEGETTIDRIYHLDRGYENIEAKLGALGASIRRI
DDRAGAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagatcgtagtcagcggcggcgtgccgctccgtggcgaagtcgccatctccggc
gccaagaacgccgtgctccccatcctgtgcgcgaccctgctggccgacgcgccggtggag
atcgtcaacgtccccgacctgcatgacgtgcgcaccacgctcaagctgctgggcgagctc
ggcgcgagcgtgcggtacgtcgacggcgagctggcgcgcagcctggtggtcgatccgtgc
accgtttcccagcacgtggcgccctacgacctggtcaagaccatgcgcgcctcgatcctg
gtgctgggcccgctgctggcgcgccacggcgcggccgaagtggccctgcccggcggctgc
gcgatcggctcgcgcccggtggaccagcacatccgcggcctgcaggcgctgggcgccgag
atcaacgtcgagaacggctacatcaaggcccgcgccgggcgcctgaagggcgcgcgcttc
gtgttcgacatggtgaccgtcaccggcaccgagaacgtcatggccgccgccaccctcgcc
gaaggcaccacggtgctcgagaacgcggcgatggagccggaggtggtcgacctggccgac
tgcctcaacgcgctgggcgcgcggatcgagggcgcgggcacctcgcgcatcaccatccac
ggcgtcgagcgcctcggcggcggccgccatgtggtcctgccggaccgcatcgagaccggc
accttcctggtggccgcggcgatgaccggcggccgcgtgaccacgctcaacgcgcgtccg
gacaccctggaagcagtgctggacaagctcagggaagctggcgccacggtcaccaccacc
gccgacagcatcaccgtggacatggaaggccggcgtccgcgcgcggtcggcctgaccacc
gcgccgtacccggcgttcccgaccgacatgcaggcgcagttcatggcgctcaactgcgtg
gccgagggcgtgggcgtgatcagcgagacgatcttcgaaaaccgcttcatgcacgtcaac
gagctgctgcgcctgggcgcggacatccagatcgacggccataccgcggtggtgcgtggc
gtgcagcgcctcagcggtgcgccggtgatggcgaccgacctgcgcgcctcggcctcgctg
atcctcgccggcctggtggccgagggcgagaccacgatcgaccgcatctaccacctggat
cgcggctacgagaacatcgaggccaagctcggcgcgctgggcgccagcatccgccgcatc
gacgaccgcgcgggagccgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system