KEGG   Pseudoxanthomonas suwonensis: Psesu_1234Help
Entry
Psesu_1234        CDS       T01403                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:psu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1356894..1358045
Genome map
AA seq 383 aa AA seqDB search
MGNDSLSLQAIPSWRRAVLKVGSSLLAADGGGGLSPRFALGLAQFVSSSVLAGREVVIVS
SGAVAAGRAILPRAAEAGAAMAQRQALAALGQARLIELWQRFFERPVAQVLLTHDDLRNR
RRYLNARATLKELLALGTLPVVNENDTVSVDELKLGDNDNLAAIVAALIDADVLFIATDI
DGLYDANPRTNPGAKLLPEVLELGPEVLAMAGGSGSAVGTGGMRTKLEAAAKAGAAGIDT
VLFNGRRPEVVRELVHDRLHGTRIRAARSRIAARKYWLRHAPLERGARIVVDAGAAGALA
GKGASLLPGGVLAAEGEFRRGDMVEVVVRGQAGDSAIARGISQYSAVDVGRIAGRHSRDI
ESILGYNYGGNVIHRDDLVLLGS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgattccctgtccctgcaggccatcccgtcctggcgccgcgcggtgctcaag
gtcggcagcagcctgctggccgccgacggcggcggtggactgtcgccgcgcttcgccctg
ggcctggcccagttcgtgtcctcctcggtactggccggccgcgaggtggtgatcgtgtcc
tccggcgcggtcgccgccggccgcgccatcctgccgcgcgcggccgaggccggcgccgcc
atggcccagcgccaggcgctggccgcgcttggccaggcgcgcctgatcgagctgtggcag
cgcttcttcgagcgtccggtggcgcaggtgctgctgacccacgacgacctgcgcaaccgc
cgccgctacctcaacgcccgcgccacgctcaaggagctgctggcactgggcacgctgccg
gtggtcaacgagaacgacaccgtctcggtggacgagctcaagctcggcgacaacgacaac
ctggccgcgatcgtcgccgccctgatcgacgcggacgtgctgttcatcgccaccgacatc
gacggcctgtacgacgccaacccgcgcacgaaccccggcgcgaagctgctgcccgaggtg
ctggagctcggccccgaggtgctggccatggccggcggcagcggcagcgcggtcggtacc
ggcggcatgcgcaccaagctcgaggccgcggccaaggccggcgcggccggcatcgacacc
gtgctgttcaacgggcgtcgcccggaagtggtgcgcgagctggtccatgaccgcctgcac
ggcacccgcatccgcgccgcgcgcagccgcatcgccgcgcgcaagtactggttgcggcac
gcgccgctggagcgtggcgcgcgcatcgtggtcgatgccggcgccgccggtgcgctggcc
ggcaagggcgcctcgctgctgccgggcggcgtgctcgcggccgagggcgagttccgccgc
ggcgacatggtcgaagtggtggtgcgcggccaggctggtgacagtgcgatcgcccgcggc
atcagccagtactcggcggtggacgtcggccggatcgccggccgccactcgcgcgacatc
gaatccatcctgggctacaactacggcggcaacgtcatccaccgcgacgacctggtgctg
ctggggtcgtga

DBGET integrated database retrieval system