KEGG   Pseudoxanthomonas suwonensis: Psesu_1297Help
Entry
Psesu_1297        CDS       T01403                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:psu01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:psu00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:psu00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:psu00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1420714..1421097
Genome map
AA seq 127 aa AA seqDB search
MSRYRTPLKNVRGLGTAKTGTDHFVHQRLTATALVFLSLWFVYFVLGLVGSDYMAATDAV
SKPWNAVLLVGFLVAMFWHAQLGLQVVLEDYVHNSLVALALQVSVKFIAVLGAIVSIFAV
ARIALAG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgttaccgtacccccctgaagaacgtgcgcggccttggcaccgccaagaccggc
accgaccacttcgtccaccagcgcctgaccgccaccgcgctggtcttcctgtcgctgtgg
ttcgtctacttcgtcctcggcctggtcggcagcgactacatggccgccaccgacgccgtg
tccaagccgtggaacgccgtgctgctggtcggcttcctggtcgccatgttctggcacgcc
cagctgggcctgcaagtggtcctcgaggactacgtccacaactcgctggtcgccctggcg
ctccaggtcagcgtgaagttcatcgcggtgcttggcgcgatcgtcagcatcttcgccgtc
gcccgcatcgcgctggccggctga

DBGET integrated database retrieval system