KEGG   Pseudoxanthomonas suwonensis: Psesu_1335Help
Entry
Psesu_1335        CDS       T01403                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Psesu_1335
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Psesu_1335
Enzymes [BR:psu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Psesu_1335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1471424..1472422)
Genome map
AA seq 332 aa AA seqDB search
MLVIGVAGTELTAQERDWLQHDAVAGVILFKRNFASRAQVAELASAIREAAPRPQLVCVD
QEGGRVQRFREGYSELPPLQRLGELYARDPQAALALAEEHAWLMASEIRASGVDLSFAPV
VDLGRGNRAIGDRAFAAEPQVVAELTRAYVRGMHSVGMGATLKHFPGHGTVLEDTHFDHA
VDPRPLEALRAEDLVPFVAGIEAGADAVMMGHVQYPAIAPEPAGYSPFWIGRFLRGELGF
RGVVFSDDIGMAAAHGVGGVRTRVLAHLDAGCDVVLVCHPELVAESLEAVRDRRLNTAAL
LGLVGRGALGWDGLLADARHASARGRLPPSAA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgatcggcgtcgccggcaccgaactgaccgcgcaggagcgcgactggctgcag
cacgatgcagtcgccggcgtgatcctgttcaagcgcaatttcgcctcgcgcgcgcaggtc
gccgaactggcctccgccatccgcgaggccgccccgcgtccgcagctggtctgcgtggac
caggaaggcggccgcgtgcagcgtttccgcgagggttacagcgagctgccgccgctgcag
cgcctcggcgagctgtacgcccgcgacccgcaggccgccctggccctggccgaggagcac
gcctggctgatggccagcgagatccgcgccagcggcgtggacctgagcttcgccccggtg
gtcgacctgggccgcggcaaccgtgccatcggcgaccgcgccttcgccgccgagccgcag
gtggtggccgagctcacccgtgcctacgtgcgcggcatgcattcggtgggcatgggcgcc
accctcaagcatttccccgggcacggcaccgtgctcgaggacacccacttcgaccacgcg
gtggacccgcgcccgctggaagcgctgcgcgccgaggacctggtgccgttcgtggccggg
atcgaggccggcgccgacgcggtgatgatgggccacgtgcagtacccggcgatcgccccg
gaaccggcaggctactcgccgttctggatcggacggttcctgcgcggcgaactcggtttc
cgcggggtagtgttctccgatgacatcggcatggccgccgcgcacggcgtgggcggggtc
cgcacccgcgtgctggcgcacctggatgccggctgcgacgtggtgctggtctgccatccg
gaactggtcgccgaatcgctggaggctgtccgcgaccgccgcctcaacaccgccgccctg
ctcggcctggtcggccgcggcgccctcggctgggatggcctgctggccgacgcgcgccac
gccagcgcccgcggccgcctgcccccttccgccgcctga

DBGET integrated database retrieval system