KEGG   Pseudoxanthomonas suwonensis: Psesu_1390Help
Entry
Psesu_1390        CDS       T01403                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Psesu_1390
   00052 Galactose metabolism
    Psesu_1390
   00500 Starch and sucrose metabolism
    Psesu_1390
   00520 Amino sugar and nucleotide sugar metabolism
    Psesu_1390
Enzymes [BR:psu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Psesu_1390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1536567..1537457
Genome map
AA seq 296 aa AA seqDB search
MTKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAIEAGCDTLVFVTNR
YKHSIADYFDKHYELEQKLEQGGKLEQLQLVSKPLPDHVRVVYVTQKEALGLGHAVLCAK
DVIGDEPFAVLLPDDLMWNRGDGALKQMADLAERTGGGVIAVEEVPREKTSSYGIVATRD
FQGRSGRIEAMVEKPKPEDAPSNLAVVGRYILPGGIFQKLETTGRGAGGEIQLTDAIAAT
IKDGGHIDAYHFVGRRFDCGAHIGLIEATVHFALEHPKHGAAAREAMQAALDEKRG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaggattcgcaaggcagtcttcccggtagccggtcttggtacccggttcctc
cccgcaaccaagaccgttcccaaggaaatgctgccgatcatcgaccggccgctgatccag
tacgcggtggatgaggccatcgaggccgggtgcgacaccctggtgttcgtcaccaaccgc
tacaagcattcgattgccgactatttcgacaagcactacgagctggagcagaagctcgag
cagggcggcaagctggagcagctgcagctggtcagcaagccgctgccggaccacgtccgc
gtggtgtacgtcacccagaaggaagccctgggcctgggccacgccgtgctctgcgccaag
gacgtgatcggcgacgagccgttcgcggtcctgctgccggacgacctgatgtggaaccgc
ggcgacggcgcgctgaagcagatggccgacctggccgagcgcaccggcggcggcgtgatc
gcggtcgaggaagtgccgcgggagaagacctccagctacggcatcgtcgccacccgcgac
ttccagggccgcagcggccgcatcgaggccatggtcgagaagcccaagcccgaggacgcg
ccgagcaacctggccgtggtcggccgctacatcctgcccggcggcatcttccagaagctg
gagaccaccggccgcggtgccggcggcgagatccagctgaccgacgcgatcgccgcgacg
atcaaggacggcggccatatcgatgcctaccacttcgtcggccgtcgcttcgactgtggt
gcgcacatcggcctgatcgaggcgaccgtgcacttcgcgctggagcacccgaagcatggt
gcggccgcgcgcgaggcgatgcaggcggcgctggacgagaagcgcggctga

DBGET integrated database retrieval system