KEGG   Pseudoxanthomonas suwonensis: Psesu_1390Help
Entry
Psesu_1390        CDS       T01403                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Psesu_1390
   00052 Galactose metabolism
    Psesu_1390
   00500 Starch and sucrose metabolism
    Psesu_1390
   00520 Amino sugar and nucleotide sugar metabolism
    Psesu_1390
Enzymes [BR:psu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Psesu_1390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1536567..1537457
Genome map
AA seq 296 aa AA seqDB search
MTKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAIEAGCDTLVFVTNR
YKHSIADYFDKHYELEQKLEQGGKLEQLQLVSKPLPDHVRVVYVTQKEALGLGHAVLCAK
DVIGDEPFAVLLPDDLMWNRGDGALKQMADLAERTGGGVIAVEEVPREKTSSYGIVATRD
FQGRSGRIEAMVEKPKPEDAPSNLAVVGRYILPGGIFQKLETTGRGAGGEIQLTDAIAAT
IKDGGHIDAYHFVGRRFDCGAHIGLIEATVHFALEHPKHGAAAREAMQAALDEKRG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaggattcgcaaggcagtcttcccggtagccggtcttggtacccggttcctc
cccgcaaccaagaccgttcccaaggaaatgctgccgatcatcgaccggccgctgatccag
tacgcggtggatgaggccatcgaggccgggtgcgacaccctggtgttcgtcaccaaccgc
tacaagcattcgattgccgactatttcgacaagcactacgagctggagcagaagctcgag
cagggcggcaagctggagcagctgcagctggtcagcaagccgctgccggaccacgtccgc
gtggtgtacgtcacccagaaggaagccctgggcctgggccacgccgtgctctgcgccaag
gacgtgatcggcgacgagccgttcgcggtcctgctgccggacgacctgatgtggaaccgc
ggcgacggcgcgctgaagcagatggccgacctggccgagcgcaccggcggcggcgtgatc
gcggtcgaggaagtgccgcgggagaagacctccagctacggcatcgtcgccacccgcgac
ttccagggccgcagcggccgcatcgaggccatggtcgagaagcccaagcccgaggacgcg
ccgagcaacctggccgtggtcggccgctacatcctgcccggcggcatcttccagaagctg
gagaccaccggccgcggtgccggcggcgagatccagctgaccgacgcgatcgccgcgacg
atcaaggacggcggccatatcgatgcctaccacttcgtcggccgtcgcttcgactgtggt
gcgcacatcggcctgatcgaggcgaccgtgcacttcgcgctggagcacccgaagcatggt
gcggccgcgcgcgaggcgatgcaggcggcgctggacgagaagcgcggctga

DBGET integrated database retrieval system