KEGG   Pseudoxanthomonas suwonensis: Psesu_1585Help
Entry
Psesu_1585        CDS       T01403                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:psu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1750757..1751776)
Genome map
AA seq 339 aa AA seqDB search
MSRTTLLAGLCLGLMALLPNAMAADPRPLSAADQVARMGAGVNVLGYDPYWKAGEQGNYR
EEHFAKIREAGFGTVRVALFTFPHLDEANRLDPQWLAKLDQVIGWGTGNGLQVILDVHDF
NDCVKDVPACEVKLEQVWTQLGERYAGQPDQVVFELLNEPHGALDAKAWNGLFAKLLEVV
RRTNPTRNVVVGPTRWNNLEELDTLQLPEDDRHLIVTFHYYEPFAFTHQGASWVEPQFSE
KTGVRFNTPGQVAKIESDFDKVKAWSRKHDRPILLGEYGAYDKAPMEDRVYWTRTVARAA
EKRGFAHLYWQFSSDFVLYDFEREKWVQPLLEAVIPPKP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaccaccttgcttgccgggctctgcctgggcctgatggcgctgctgcccaac
gccatggccgccgatcccaggccgctgtccgccgctgaccaggtcgcgcgcatgggagcc
ggggtcaacgtgctgggctacgacccgtactggaaggcgggcgagcagggcaattaccgc
gaggagcatttcgcgaagatccgcgaggccggcttcggcacggtgcgcgtggcgctgttc
accttcccgcacctggacgaggccaaccggctcgatccgcaatggctggccaagctggac
caggtgatcggctggggcacgggcaatggcctgcaggtgatcctggacgtgcacgacttc
aacgactgcgtgaaggacgtgccggcctgcgaggtgaagctggagcaggtctggacccag
ctgggcgagcgctatgccggccagccggaccaggtggtgttcgaactgctcaacgagccg
cacggcgcactcgatgccaaggcctggaacgggctgttcgcgaagctgctggaggtggtg
cgcaggaccaatcccacccgcaacgtggtggtcggcccgacccgctggaacaacctcgag
gagctggacacgctgcagctgccggaggacgacaggcacctgatcgtgaccttccactac
tacgagccgttcgccttcacccaccagggcgcgagctgggtggagccgcagttctcggag
aagaccggcgtgcgcttcaacacgccagggcaggtggcgaagatcgaaagcgacttcgac
aaggtcaaggcgtggtcgcgcaagcatgaccggccgatcctgctgggcgaatacggcgcc
tacgacaaggcgccgatggaggaccgggtgtactggacccggaccgtggcccgggccgcg
gagaagcgcggcttcgcccacctgtactggcagttctccagcgacttcgtgctgtacgac
ttcgaacgcgagaagtgggtgcagccgctgctggaggcggtgattccgccgaagccgtaa

DBGET integrated database retrieval system