KEGG   Pseudoxanthomonas suwonensis: Psesu_1601Help
Entry
Psesu_1601        CDS       T01403                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Psesu_1601
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Psesu_1601
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psesu_1601
Enzymes [BR:psu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Psesu_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1764692..1766332)
Genome map
AA seq 546 aa AA seqDB search
MGIDIERRRLVLAGGLGVGALLLPGGKALAAELLGARGFTHSVASGEPGADSMLLWTRYV
PAAGGDEVQLQAEVALDHGFSRVVAGGTVRTGAYRDWTAKLTVTGLAPGTTHWYRFIAPD
GARSPVGRMRTLPDGPVARFGLAVFSCSNLPNGWFNAYAHAAQREDLDLWLHVGDYIYEY
GIGSYREHDRIPGRILMPAHEREMVSLLDYRLRFACYRADPDLQKLHQDAAMVALWDDHE
ITNDSWEGGAQNHQPATEGDWNTRRAAAVQAYREWMPVSEEPWKAYRIGTLATLYRTESR
LTGRTRPLYPELDQAHRAGNPGPALEAFRDGTWQDPSASMLGWEQEAWLADTMQREARVT
AWQLVGMATIMGRTLMPEEMPGWLRPEASERTREAFRRNVYASRLGVPMWMDRWDGYPAA
RSRLLQAAQRADADLVMLSGDSHNAWAYSLVEDGRPAGVEFAGQAVTSRGMEGNLAADPR
DVAQAFIKANPELAWADTSQRGYMMIEVRAAQVTGQWVFMQDIKRRTTALAGTHHMKVAR
GRRRFA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcgatatcgaacggcgccggctggtgctggcgggcggcctcggcgtgggtgcg
ctgttgctgccgggcggaaaggcgctggcggccgagctgctgggcgccagggggttcacc
cacagcgtcgccagcggcgagcccggcgcggacagcatgctgctgtggacgcgctacgtg
ccggcggccggcggggatgaagtgcagctgcaggccgaggtcgcgctggaccatgggttc
agccgggtggtcgcgggcggcacggtccgcaccggcgcctaccgtgactggacggccaag
ctgaccgtcaccggcctggcgccgggcaccacccactggtaccgcttcatcgcaccggat
ggcgcgcgttcccccgtggggcgcatgcgcacgctgccggatggcccggtggcgcgcttc
gggctggcggtgttctcctgttccaacctgcccaatggctggttcaacgcctatgcgcac
gcggcccagcgcgaggacctggacctgtggctgcacgtgggcgactacatctacgagtac
gggatcggttcctaccgcgaacacgaccgcatccccgggcgcatcctcatgcctgcgcat
gagcgggagatggtgtcgctgctggactaccgcctgcgcttcgcctgctaccgtgccgat
ccggacctgcagaagctgcaccaggacgcggccatggtggcgctgtgggacgaccacgag
atcaccaacgacagctgggaggggggcgcgcagaaccaccagccggcgaccgagggcgac
tggaacacccgccgtgccgcggcggtgcaggcgtaccgcgagtggatgccggtctcggag
gaaccatggaaggcctaccgcatcggcaccctggccacgctctaccggaccgaatcacgc
ctgaccgggcgcacccggccgctgtatccggagctggaccaggcccatcgcgccggcaac
ccgggcccggcgctggaggcgttccgcgacgggacgtggcaggacccatcggcaagcatg
cttggatgggagcaggaggcctggctggccgacaccatgcagcgcgaggcgcgggtgact
gcgtggcagctcgtgggcatggcgacgatcatgggacgcacgttgatgccggaggagatg
cccggctggttgcgcccggaggcaagcgagcgcacccgcgaggcgttccgccggaacgtg
tacgcatcgcggctgggggtgccgatgtggatggaccgctgggacggctatccggcggcg
cgctcgcgcctgctgcaggcggcgcagcgtgccgatgccgacctggtgatgctgtccggc
gacagccacaacgcctgggcgtactcgctggtggaggacggccggcctgcaggcgtggag
ttcgccggacaggcggtgacctcgcgcggcatggagggcaacctggcggccgatccgcgg
gacgtggcgcaggcgttcatcaaggccaacccggaactggcctgggccgataccagccag
cgcggctacatgatgatcgaggtcagggccgcgcaggtgaccgggcaatgggtgttcatg
caggacatcaagcgccgcaccaccgcgctggccggcacccaccacatgaaggtggcccgg
ggccggcgccgcttcgcctag

DBGET integrated database retrieval system