KEGG   Pseudoxanthomonas suwonensis: Psesu_1771Help
Entry
Psesu_1771        CDS       T01403                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:psu00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:psu00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1953259..1953837)
Genome map
AA seq 192 aa AA seqDB search
MSRWLIALGLMMTGPGAALAAGADLLDLEYRPLASRSPVNLAERHAGQVLLVVNTASKCG
FTPQYEGLEALQKRYAARGFSVVGFPSNDFRGQEPGDEAQIQEFCTLTYGVEFPMYEKVH
VIGEEATPLYRRLAAATGVQPGWNFHKYLVSRGGRVVGNWPSKVEPGDPALVAAIERELA
RPAPRGAAAGTR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggtggctgattgcattgggtttgatgatgacggggccgggcgcggccctggcc
gcgggcgccgacctgctggaccttgagtaccggccgctggcctcgcgcagcccggtgaac
ctggccgagcgccacgccgggcaggtgctgctggtggtcaataccgccagcaagtgcggc
ttcaccccccagtacgagggcctggaggcgctgcagaagcgctatgccgcccgcggtttc
tcggtggtcggcttcccgtccaacgatttccgcggccaggagccgggcgacgaggcccag
atccaggagttctgcaccctgacctacggggtggagttccccatgtacgagaaggtgcac
gtgatcggcgaggaggccacgccgctttaccgccgcctggccgccgccaccggcgtgcag
ccgggctggaacttccacaagtacctggtgtcgcggggcgggcgggtggtcggcaactgg
ccgagcaaggtcgagccgggcgacccggcgctggtggccgcgatcgagcgcgaactggcc
cgcccggcaccgcgcggggccgccgccggcacgcgctga

DBGET integrated database retrieval system