KEGG   Pseudoxanthomonas suwonensis: Psesu_1785Help
Entry
Psesu_1785        CDS       T01403                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psesu_1785
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psesu_1785
  Amino acid metabolism
   00310 Lysine degradation
    Psesu_1785
Enzymes [BR:psu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Psesu_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1968566..1969771
Genome map
AA seq 401 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKAGDSVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FSEGDTVTSQQVLAIIEEGAVAEAAPAEEKKAEAPKAEAPKAEAPAKAAAPAPAARTGGA
ELPPGARATAAREGVDASQVEGTGRRGAVTKEDILNYARTGGAGKAGGARPEERVPMTRI
RKRIAERLMQSKDSIAMLTSFNEVNLAKVSAARKQLGEDFQKTHGIKLGFMSFFVKAAAN
ALQRFPIINASVDGDDIIYHGYSDISIAVSTDKGLVTPVLRNVERMGFADIEQGIADYAK
KARDGKLGLDDLQGGTFTITNGGTFGSLMSTPIVNPPQSAILGMHTIKERPIAENGQVVI
APMMYIALSYDHRIIDGKDAVQFLVDIKNQLENPNRMLFGL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtcctccccgaatccgtctccgacgccaccatcgcc
agctggcacaagaaggccggtgactcggtcaagcgcgacgagaacctggtggacctggag
accgacaaggtcgtgctcgaagtcccctcgccggtcgacggcgtcctgaaggagatcaag
ttctccgagggcgacaccgtgaccagccagcaggtgctggcgatcatcgaggaaggcgcg
gtagccgaggccgccccggcggaagagaagaaggccgaagcgcccaaggccgaggccccg
aaggccgaggctccggccaaggcggccgctccggccccggccgccaggaccggcggcgca
gagctgcccccgggcgcccgcgccaccgctgcccgtgaaggcgtcgacgcctcgcaggtc
gagggcaccggccgccgcggcgcggtgaccaaggaagacatcctcaactacgcccgcacc
ggcggcgccggcaaggccggcggcgcgcgtccggaagagcgcgtgccgatgacccgcatc
cgcaagcgcatcgccgagcgcctgatgcagtccaaggactccatcgccatgctgacttcg
ttcaatgaggtcaacctggccaaggtgtcggccgcccgcaagcagctgggcgaggacttc
cagaagacccacggcatcaagctgggcttcatgagcttcttcgtgaaggccgcggccaac
gccctgcagcgcttcccgatcatcaacgcctcggtcgacggcgacgacatcatctaccac
ggctattcggacatttcgatcgccgtgtccaccgacaagggcctggtcaccccggtcctg
cgcaacgtcgagcgcatgggcttcgccgacatcgagcagggaatcgccgactacgccaag
aaggcgcgcgacggcaagctgggcctggacgacctgcagggcggcaccttcaccatcacc
aacggcggcaccttcggctcgctgatgtcgaccccgatcgtcaacccgccgcagagcgcc
atcctgggcatgcacaccatcaaggagcgcccgatcgccgagaacggccaggtcgtgatc
gcgccgatgatgtacatcgcgctgtcctacgaccaccgcatcatcgacggcaaggacgcg
gtgcagttcctggtcgacatcaagaaccagctcgagaacccgaaccgcatgctgttcggt
ctgtaa

DBGET integrated database retrieval system