KEGG   Pseudoxanthomonas suwonensis: Psesu_1810Help
Entry
Psesu_1810        CDS       T01403                                 

Definition
acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:psu00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1997717..1998271
Genome map
AA seq 184 aa AA seqDB search
MSRLRIFDENRPEQPLFESTDGNAIAAELARVGVTFERWHASKPITPGASPEEVIEAYRT
DIDRLVAARGFKTVDVVSIAPDNPNREEMRRKFLDEHFHKEDEVRFFVAGSGLFTLHLDD
KVYEVECVKDDLIAVPDGTRHWFDMGESPSFVAIRFFTEPDGWVGHFTGTDIAQRFPRYE
PQVH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactgcgcatcttcgacgagaaccgccccgaacagccgctgttcgagagcacc
gacggcaatgccatcgccgccgagctggcgcgcgtgggcgtgaccttcgagcgctggcac
gcgtccaagccgatcacccccggtgccagcccggaggaagtgatcgaggcctaccgcacc
gacatcgaccgcctggtcgccgcgcgcggcttcaagaccgtggacgtggtcagcatcgcc
ccggacaacccgaaccgcgaggagatgcgccggaagttcctcgacgagcacttccacaag
gaagacgaggtgcgcttcttcgtcgctggctcgggcctgttcaccctgcacctggacgac
aaggtctacgaggtcgagtgcgtcaaggacgacctgatcgcggtgccggatggcacccgc
cactggttcgacatgggcgagtcgccgagcttcgtcgccatccgcttcttcaccgaaccg
gatggctgggtcggccacttcaccggcaccgacatcgcccagcggttcccgcgctacgaa
ccgcaggtgcactga

DBGET integrated database retrieval system