KEGG   Pseudoxanthomonas suwonensis: Psesu_1847Help
Entry
Psesu_1847        CDS       T01403                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psesu_1847
   01230 Biosynthesis of amino acids
    Psesu_1847
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psesu_1847
   00051 Fructose and mannose metabolism
    Psesu_1847
   00562 Inositol phosphate metabolism
    Psesu_1847
Enzymes [BR:psu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Psesu_1847
Exosome [BR:psu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Psesu_1847
  Exosomal proteins of bladder cancer cells
   Psesu_1847
  Exosomal proteins of melanoma cells
   Psesu_1847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2039144..2039902)
Genome map
AA seq 252 aa AA seqDB search
MRRRIVAGNWKLYGTRDFATSLVAEVAGQAPVEGVELVVMPPMPYLGDLIEDFEGSALQF
GAQDVSPHGEGAYTGEVSARMVADVGARYTLCGHSERRRYHAESSELVARKVKAALEAGL
VPVLCVGEHLEDREAGRAEEVIASQLQPVLDLVGAGGLANAVVAYEPCWAIGTGRTASPE
QAQEIHAFIRRQIARHDARIADSLPILYGGSVKPDNAGALCAQPDVDGGLIGGASLVAAD
FLAIARAAAAAR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcaggatcgtcgcgggcaactggaaactctatggcacgcgggacttcgccacc
tcgctggtggcggaagtcgcaggccaggccccggtcgagggcgtggagctggtggtcatg
ccaccgatgccctacctgggcgacctgatcgaggacttcgagggttcggccctgcagttc
ggtgcccaggacgtcagtccgcacggcgagggcgcctataccggcgaggtctcggcgcgg
atggtggccgacgtcggtgcgcgctacaccctgtgcggccattccgagcgccgccgctac
cacgccgaatccagcgagctggtcgcgcgcaaggtcaaggcggccctcgaggccggcctg
gtcccggtgctgtgcgtgggcgagcacctggaggaccgcgaggccgggcgtgccgaggaa
gtcatcgcctcccagctgcagccggtgctggacctggtcggggccgggggcttggccaac
gccgtggtggcctacgagccgtgctgggccatcggcacgggccggaccgcctccccggag
caggcccaggagatccacgcattcatccgtcgccagatcgccaggcacgatgctagaatt
gcggattcgctgccgatcctgtacggcggcagcgtgaagcccgacaacgccggtgcgctg
tgtgcgcagccggacgtggacggcgggctgatcggtggcgcctccctggtggccgccgat
ttccttgccattgcccgggccgctgcggcggcccggtaa

DBGET integrated database retrieval system