KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_1847Help
Entry
Psesu_1847        CDS       T01403                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00010  Glycolysis / Gluconeogenesis
psu00051  Fructose and mannose metabolism
psu00562  Inositol phosphate metabolism
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01120  Microbial metabolism in diverse environments
psu01130  Biosynthesis of antibiotics
psu01200  Carbon metabolism
psu01230  Biosynthesis of amino acids
Module
psu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psesu_1847
   00051 Fructose and mannose metabolism
    Psesu_1847
   00562 Inositol phosphate metabolism
    Psesu_1847
Enzymes [BR:psu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Psesu_1847
Exosome [BR:psu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Psesu_1847
  Exosomal proteins of bladder cancer cells
   Psesu_1847
  Exosomal proteins of melanoma cells
   Psesu_1847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PHY
Motif
Other DBs
NCBI-ProteinID: ADV27689
JGI: Psesu_1847
UniProt: E6WU40
Position
complement(2039144..2039902)
Genome map
AA seq 252 aa AA seqDB search
MRRRIVAGNWKLYGTRDFATSLVAEVAGQAPVEGVELVVMPPMPYLGDLIEDFEGSALQF
GAQDVSPHGEGAYTGEVSARMVADVGARYTLCGHSERRRYHAESSELVARKVKAALEAGL
VPVLCVGEHLEDREAGRAEEVIASQLQPVLDLVGAGGLANAVVAYEPCWAIGTGRTASPE
QAQEIHAFIRRQIARHDARIADSLPILYGGSVKPDNAGALCAQPDVDGGLIGGASLVAAD
FLAIARAAAAAR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcaggatcgtcgcgggcaactggaaactctatggcacgcgggacttcgccacc
tcgctggtggcggaagtcgcaggccaggccccggtcgagggcgtggagctggtggtcatg
ccaccgatgccctacctgggcgacctgatcgaggacttcgagggttcggccctgcagttc
ggtgcccaggacgtcagtccgcacggcgagggcgcctataccggcgaggtctcggcgcgg
atggtggccgacgtcggtgcgcgctacaccctgtgcggccattccgagcgccgccgctac
cacgccgaatccagcgagctggtcgcgcgcaaggtcaaggcggccctcgaggccggcctg
gtcccggtgctgtgcgtgggcgagcacctggaggaccgcgaggccgggcgtgccgaggaa
gtcatcgcctcccagctgcagccggtgctggacctggtcggggccgggggcttggccaac
gccgtggtggcctacgagccgtgctgggccatcggcacgggccggaccgcctccccggag
caggcccaggagatccacgcattcatccgtcgccagatcgccaggcacgatgctagaatt
gcggattcgctgccgatcctgtacggcggcagcgtgaagcccgacaacgccggtgcgctg
tgtgcgcagccggacgtggacggcgggctgatcggtggcgcctccctggtggccgccgat
ttccttgccattgcccgggccgctgcggcggcccggtaa

DBGET integrated database retrieval system