KEGG   Pseudoxanthomonas suwonensis: Psesu_1890Help
Entry
Psesu_1890        CDS       T01403                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psesu_1890
   01230 Biosynthesis of amino acids
    Psesu_1890
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psesu_1890
  Energy metabolism
   00680 Methane metabolism
    Psesu_1890
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psesu_1890
Enzymes [BR:psu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Psesu_1890
Exosome [BR:psu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Psesu_1890
  Exosomal proteins of melanoma cells
   Psesu_1890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2088949..2089698)
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLENRFTGWVDVDLTEQGRAEAAAGGRLMREEGLRFDVAYTSTLK
RAIRTLNLALGELDQDWIPVHKSWRLNERHYGALQGLDKAETAAKHGEEQVKIWRRSYDI
PPPAMDPSDAGHPANDPRYTGLDRNALPSTESLATTLDRVLPYWHDAIAPSLKSGKTVLV
AAHGNSLRALYKYLNNVSKEEILELNIPTGIPLQFELDDELNVVSYRYLGDPEAAARAAA
AVAAQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcaagcttgtcctgctgcgccacggccagagccagtggaacctcgagaaccgc
ttcaccggctgggtcgacgtcgacctgaccgaacagggccgcgccgaggccgccgccggt
ggccggctgatgcgcgaggaaggcctgcgcttcgacgtggcctatacctccaccctcaag
cgcgccatccgcaccctcaacctcgccctgggcgagctggaccaggactggatcccggtg
cacaagagctggcgcctcaacgagcgccactacggcgcgctgcagggcctggacaaggcc
gagaccgcggccaagcacggcgaggagcaggtcaagatctggcgccgctcgtacgacatc
ccgccgccggcgatggatccgtccgatgccggccacccggccaacgatccgcgctacacc
ggcctggaccgcaacgcgctgccgtcgaccgagtcgctggccaccaccctggaccgcgtg
ctgccgtactggcacgacgccatcgccccgtcgctgaagtcgggcaagacggtgctggtc
gccgcgcacggcaactcgctgcgcgcgctgtacaagtacctcaacaacgtctcgaaggaa
gaaatcctcgagctcaacatccccaccggcatcccgctgcagttcgagctggacgacgag
ctcaacgtggtctcgtaccgctacctcggcgatccggaggccgcggcccgcgccgccgcc
gcggtcgccgcccagggcaaggccaagtaa

DBGET integrated database retrieval system