KEGG   Pseudoxanthomonas suwonensis: Psesu_1935Help
Entry
Psesu_1935        CDS       T01403                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psesu_1935
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psesu_1935
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psesu_1935
Enzymes [BR:psu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psesu_1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2139691..2140905)
Genome map
AA seq 404 aa AA seqDB search
MTSSIQDFHAYPDTSGHFGQHGGRFVAETLMGPLQELAAAYDQARVDPAFIAAFDKDLKH
YVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLAARMGKKRIIAET
GAGQHGVASATVATRLGLECVVYMGATDIERQKINVYRMKLLGATVVPVTSGSATLKDAL
NEAMRDWVTNVQDTFYIIGTVAGPDPYPRMVRDFNAVVGREARAQMLTDYGRLPDVITAC
VGGGSNAIGLFHAFLNDRDVRIVGAEAAGDGVATGRHAASLSAGRVGVLHGNRTYVLCDD
DGQIIETHSISAGLDYPGVGPEHSFLQDSGRAEYVGVTDEEALEAFHKLTRTEGILPALE
SSHAVAQAIKLARELPKDKLVLCNLSGRGDKDVHTIAAREGIQL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccagctccatccaggacttccacgcctatcccgacaccagcggccatttcggccag
cacggcggccgcttcgtcgccgagaccctgatggggccgctgcaggagctggccgcggcc
tatgaccaggcgcgggtcgatccggccttcatcgccgccttcgacaaggacctcaagcac
tacgtcggccggcccagcccgatctaccacgccgagcgcctgagccgggaagtgggcggt
gcgcagatcctgctcaagcgcgaggacctgaaccacaccggcgcgcacaagatcaacaac
accatcggccaggccctgctggccgcgcgcatgggcaagaagcggatcatcgccgagacc
ggcgccggccagcacggcgtggccagtgccaccgtcgccacccgcctcggcctggagtgc
gtggtctacatgggggccaccgacatcgagcggcagaagatcaacgtctaccggatgaag
ctgctgggcgcgaccgtggtcccggtgacctccggctcggccacgctcaaggacgcgctc
aacgaggccatgcgcgactgggtcaccaatgtccaggacaccttctacatcatcggaacc
gtcgccggtcccgatccgtacccgcggatggtgcgcgacttcaacgccgtggtcggccgc
gaggcgcgcgcgcagatgctcaccgactacggccgcctgccggacgtgatcaccgcctgc
gtcggcggcggcagcaatgccatcggcctgttccatgcgttcctcaacgacagggacgtg
cgcatcgtcggcgccgaggctgccggcgacggagtcgcgaccggtcgccatgcggcctcg
ctgtcggctggccgggtcggcgtgctgcacggcaaccgcacctacgtgctgtgcgacgac
gatggccagatcatcgagacccactcgatctccgccggcctggactacccgggcgtgggc
ccggagcactccttcctgcaggacagcggccgcgccgagtacgtgggcgtgaccgacgag
gaggcgctggaagccttccacaagctgacccgcaccgagggcatcctgccggcgctggaa
tccagccatgcggtcgcgcaggcgatcaagctggcgcgcgagctgccgaaggacaagctg
gtgctgtgcaacctctccggccgcggcgacaaggacgtgcacaccatcgccgcgcgcgag
ggcatccagctgtga

DBGET integrated database retrieval system