KEGG   Pseudoxanthomonas suwonensis: Psesu_1935Help
Entry
Psesu_1935        CDS       T01403                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psesu_1935
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psesu_1935
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psesu_1935
Enzymes [BR:psu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Psesu_1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2139691..2140905)
Genome map
AA seq 404 aa AA seqDB search
MTSSIQDFHAYPDTSGHFGQHGGRFVAETLMGPLQELAAAYDQARVDPAFIAAFDKDLKH
YVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLAARMGKKRIIAET
GAGQHGVASATVATRLGLECVVYMGATDIERQKINVYRMKLLGATVVPVTSGSATLKDAL
NEAMRDWVTNVQDTFYIIGTVAGPDPYPRMVRDFNAVVGREARAQMLTDYGRLPDVITAC
VGGGSNAIGLFHAFLNDRDVRIVGAEAAGDGVATGRHAASLSAGRVGVLHGNRTYVLCDD
DGQIIETHSISAGLDYPGVGPEHSFLQDSGRAEYVGVTDEEALEAFHKLTRTEGILPALE
SSHAVAQAIKLARELPKDKLVLCNLSGRGDKDVHTIAAREGIQL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccagctccatccaggacttccacgcctatcccgacaccagcggccatttcggccag
cacggcggccgcttcgtcgccgagaccctgatggggccgctgcaggagctggccgcggcc
tatgaccaggcgcgggtcgatccggccttcatcgccgccttcgacaaggacctcaagcac
tacgtcggccggcccagcccgatctaccacgccgagcgcctgagccgggaagtgggcggt
gcgcagatcctgctcaagcgcgaggacctgaaccacaccggcgcgcacaagatcaacaac
accatcggccaggccctgctggccgcgcgcatgggcaagaagcggatcatcgccgagacc
ggcgccggccagcacggcgtggccagtgccaccgtcgccacccgcctcggcctggagtgc
gtggtctacatgggggccaccgacatcgagcggcagaagatcaacgtctaccggatgaag
ctgctgggcgcgaccgtggtcccggtgacctccggctcggccacgctcaaggacgcgctc
aacgaggccatgcgcgactgggtcaccaatgtccaggacaccttctacatcatcggaacc
gtcgccggtcccgatccgtacccgcggatggtgcgcgacttcaacgccgtggtcggccgc
gaggcgcgcgcgcagatgctcaccgactacggccgcctgccggacgtgatcaccgcctgc
gtcggcggcggcagcaatgccatcggcctgttccatgcgttcctcaacgacagggacgtg
cgcatcgtcggcgccgaggctgccggcgacggagtcgcgaccggtcgccatgcggcctcg
ctgtcggctggccgggtcggcgtgctgcacggcaaccgcacctacgtgctgtgcgacgac
gatggccagatcatcgagacccactcgatctccgccggcctggactacccgggcgtgggc
ccggagcactccttcctgcaggacagcggccgcgccgagtacgtgggcgtgaccgacgag
gaggcgctggaagccttccacaagctgacccgcaccgagggcatcctgccggcgctggaa
tccagccatgcggtcgcgcaggcgatcaagctggcgcgcgagctgccgaaggacaagctg
gtgctgtgcaacctctccggccgcggcgacaaggacgtgcacaccatcgccgcgcgcgag
ggcatccagctgtga

DBGET integrated database retrieval system