KEGG   Pseudoxanthomonas suwonensis: Psesu_2015Help
Entry
Psesu_2015        CDS       T01403                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2225345..2225932)
Genome map
AA seq 195 aa AA seqDB search
MLLEELIEAFRVLPGVGRKSAQRMAYHVLERGREGGKRLATVLAEAVERIGHCAQCRDFS
EDEVCAVCASGSRDRQQLCVVETPADRLAIETATGYRGVYFVLQGRLSPLDGVGPRELGL
ETLGTRLAAGEVSEMIIATSATVEGEATAHYLAQLARQHGVRPSRLAQGLPLGGELEYVD
RGTLSHAFGTRAEMP
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcgaagaactcatcgaagccttccgcgtgctgcccggtgtcgggcgcaagagc
gcgcagcgcatggcgtaccacgtgctcgagcgcgggcgcgagggcggcaagcggctggcg
acggtgctggccgaggcggtggagaggatcgggcactgcgcgcagtgccgcgacttcagc
gaggacgaggtctgcgcggtctgcgccagtggttcgcgtgaccgccagcagctgtgcgtg
gtcgagaccccggccgaccgcctcgcgatcgagaccgccaccggctaccgcggcgtgtac
ttcgtgctgcagggacggctgtcgccgctggacggcgtcggcccgcgcgagcttggcctg
gagacgctgggcacgcgcctggcggcgggcgaggtgagcgagatgatcatcgccaccagc
gccacggtcgagggcgaggccaccgcgcactacctggcccagctggcccgccagcacggc
gtgcgtcccagccgcctggcgcagggcctgccgctgggcggtgaactggaatacgtggac
cgcggcaccctgtcccacgccttcggcacccgcgcggagatgccctga

DBGET integrated database retrieval system