KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_2015Help
Entry
Psesu_2015        CDS       T01403                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Psesu_2015
DNA repair and recombination proteins [BR:psu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Psesu_2015
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Psesu_2015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2225345..2225932)
Genome map
AA seq 195 aa AA seqDB search
MLLEELIEAFRVLPGVGRKSAQRMAYHVLERGREGGKRLATVLAEAVERIGHCAQCRDFS
EDEVCAVCASGSRDRQQLCVVETPADRLAIETATGYRGVYFVLQGRLSPLDGVGPRELGL
ETLGTRLAAGEVSEMIIATSATVEGEATAHYLAQLARQHGVRPSRLAQGLPLGGELEYVD
RGTLSHAFGTRAEMP
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcgaagaactcatcgaagccttccgcgtgctgcccggtgtcgggcgcaagagc
gcgcagcgcatggcgtaccacgtgctcgagcgcgggcgcgagggcggcaagcggctggcg
acggtgctggccgaggcggtggagaggatcgggcactgcgcgcagtgccgcgacttcagc
gaggacgaggtctgcgcggtctgcgccagtggttcgcgtgaccgccagcagctgtgcgtg
gtcgagaccccggccgaccgcctcgcgatcgagaccgccaccggctaccgcggcgtgtac
ttcgtgctgcagggacggctgtcgccgctggacggcgtcggcccgcgcgagcttggcctg
gagacgctgggcacgcgcctggcggcgggcgaggtgagcgagatgatcatcgccaccagc
gccacggtcgagggcgaggccaccgcgcactacctggcccagctggcccgccagcacggc
gtgcgtcccagccgcctggcgcagggcctgccgctgggcggtgaactggaatacgtggac
cgcggcaccctgtcccacgccttcggcacccgcgcggagatgccctga

DBGET integrated database retrieval system