KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_2413Help
Entry
Psesu_2413        CDS       T01403                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2645985..2647172)
Genome map
AA seq 395 aa AA seqDB search
MQGMSEGPDQARRGTLRALVAAAIAGALPAHVLAAPAEPPACLGPWADWRRFVDRHVEDN
GRVVDFVNADLRSTSESQSYGLFFALVDNDQLLFERILAWTRRNLSNGRPDLYLPAWLWG
QSGDGSWRVLDQNTASDGELWIAYALLEAGRLWNRPGFVQAGRQILALMNKAEVTELPGF
GTMLLPGNHGYVHAGSWTLNPCYLPLFAFRRFAAHDRKGPWGRLAERSVALVRQASPNGF
APDWTRWNGKAFVVDPDKGPMGSYDAIRTYLWAGITSPSDPLRKPLMAALAGPLRMLRAQ
GAFAEKIDVRNGVGMGAPPPGFAAALLPYLASQGQHALARAQAALVPTSGPAADSLTYYD
RCLVLFGKGWMDRRYRIAADGRLHPAWSTPCSVKR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcatgagcgaaggcccggaccaggcgcgccgcggcacgttgcgcgcgctggtc
gcggccgccatcgccggggcgttgccggcgcacgtgctggccgcaccggcggagccaccg
gcctgcctgggcccttgggccgactggcgccggttcgtcgaccgccacgtggaggacaac
gggcgggtggtggacttcgtcaacgccgacctgcgcagcacttccgagtcgcagtcctac
ggcctgttcttcgccctggtcgacaacgaccagctgctgttcgagcggatcctggcctgg
acccggcgcaacctcagcaacggccgtccggacctgtacctgccggcatggctgtggggc
cagtccggcgacggcagctggcgggtgctggaccagaacaccgcctccgacggcgaactg
tggatcgcctacgccctgctcgaggccggccggctgtggaaccgccccggcttcgtccag
gccgggcgccagatcctggcgctgatgaacaaggccgaggtcaccgagctgcccggcttc
ggcaccatgctgctgccgggcaaccatggctacgtgcatgccggcagctggaccctcaat
ccctgctacttgccgctgttcgcgttccgccgcttcgccgcgcacgaccgcaagggaccg
tggggcaggctggccgagcgcagcgtggccctggtccgccaggcctcacccaatggcttc
gcccccgactggacccgctggaacggcaaggccttcgtggtcgacccggacaagggcccg
atgggcagctacgacgccatccgcacctacctgtgggccggcatcaccagtccgtccgat
ccgctgcgcaagccgctgatggccgcgctggccgggccgctgcggatgctgcgcgcgcag
ggtgcattcgccgagaagatcgacgtgcgcaacggcgtcggcatgggcgcgccgccgccg
ggtttcgccgccgccctgctgccctacctcgccagccagggccagcacgcgctggcccgg
gcgcaggccgcgctggtgccgacctccggcccggccgccgattcgcttacctactacgac
cgctgcctcgtgctgttcggcaagggctggatggatcgccgctaccgtatcgccgccgac
gggcgcctgcaccccgcctggagtacgccatgttccgtgaaacgctga

DBGET integrated database retrieval system