KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_2422Help
Entry
Psesu_2422        CDS       T01403                                 

Definition
(GenBank) disulfide bond isomerase, DsbC/G-like protein
  KO
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Brite
Enzymes [BR:psu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Psesu_2422
Chaperones and folding catalysts [BR:psu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Psesu_2422
Secretion system [BR:psu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Psesu_2422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2659861..2660655)
Genome map
AA seq 264 aa AA seqDB search
MFRMLAVALLCATSLGACAQPAPPASAGKAATPAKAAASPGAEQAVRASLAEVIPDAEPD
YIGAAPFAGFREVLLDGQVLYVSDDGRYLVQTPPIDLKNRTAAASPGLADFRRQALAGVA
KEERIVFAPPNPVYTVTVFTDVECGYCRRMHDQIAEYNRQGIAVEYLAFPRMGMASQDFR
DMVSVWCAPDRRQALTRAKTGQPVQARSCTSPVAMHYALGKRIGVNGTPAVFAPDGTQLG
GYSPPADLRKALDRLAGKTAGGSR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttccgaatgcttgccgtcgcgctgctctgcgcgaccagccttggcgcctgtgcccag
ccggctccgcccgcgtccgccggcaaggccgccactcccgccaaggccgccgcgtcgccc
ggcgctgagcaggcggtgcgtgcctcgctggccgaggtgatcccggatgccgagccggac
tacatcggggccgcgccgttcgctggcttccgcgaggtgctgctcgacggccaggtgctg
tacgtctccgacgacggtcgctacctggtgcagaccccgccgatcgacctgaagaaccgg
accgcggccgccagccccggcctggccgacttccgccgccaggccctggccggggtggcg
aaggaggagcgcatcgtcttcgccccgccgaacccggtctacacggtcaccgtcttcacc
gacgtcgagtgcggctactgccggcgcatgcacgaccagatcgccgagtacaaccgccag
ggcatcgcggtggagtacctggccttcccgcgcatgggcatggccagccaggacttccgc
gacatggtctcggtctggtgcgcgccggaccgccgccaggcgctgaccagggccaagacc
ggccagccggtccaggcccgcagctgcaccagcccggtggcgatgcactacgcgctgggc
aagcgcatcggggtcaacggcaccccggcggtgttcgcgcccgacggcacccagctgggc
ggctattcgccgccggccgacctgcgcaaggcgctggaccggctggccggcaagaccgcc
ggcggcagccgctga

DBGET integrated database retrieval system