KEGG   Pseudoxanthomonas suwonensis: Psesu_2445Help
Entry
Psesu_2445        CDS       T01403                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psesu_2445
   00030 Pentose phosphate pathway
    Psesu_2445
   00051 Fructose and mannose metabolism
    Psesu_2445
   00052 Galactose metabolism
    Psesu_2445
   00500 Starch and sucrose metabolism
    Psesu_2445
   00520 Amino sugar and nucleotide sugar metabolism
    Psesu_2445
  Nucleotide metabolism
   00230 Purine metabolism
    Psesu_2445
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psesu_2445
Enzymes [BR:psu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Psesu_2445
    5.4.2.8  phosphomannomutase
     Psesu_2445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2684299..2685645
Genome map
AA seq 448 aa AA seqDB search
MTLPAFKAYDIRGRVPDELDEELARRIGVALADQLRPGPVVLGHDVRLSSPGLQAALSAG
LRGKGREVIDIGLCGTEEVYFQVDHLDAAGGVMVTASHNPMDYNGMKLVRENARPISSDT
GLFAISDAAEADTAPAAAPTAGETSRTDKTAYIEHLLSYVDVATLKPLKLVVNAGNGGAG
AIIDLLAPHLPLEFVRINHEPDGSFPNGIPNPLLPENRQATIDAVREHGADFGIAWDGDF
DRCFFFDEQGRFIEGYYLVGLLAQAILAKHPGGKVVHDPRLVWNTVEQVQEAGGVPVLCK
SGHAFIKEKMRAEDCVYGGEMSAHHYFREFAYADSGMIPWLLIAGLVSTSGRSLGDLVEA
RVRKFPCSGEINFRVADAKAAVARVMDHFAAQSPALDHTDGISADFGDWRFNLRSSNTEP
LLRLNVEARGDEALLKARTEEISRLISA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgacccttcccgccttcaaggcctacgacatccgcggccgcgttccggacgaactggac
gaggagctggcgcgccggatcggcgtcgccctcgccgaccagctgcgcccgggcccggtg
gtgctgggccacgacgtgcgcctgagcagccccggcctgcaggcggcgctgtcggccggc
ctgcgcggcaagggtcgggaggtcatcgacatcggcctgtgcggcaccgaggaggtctac
ttccaggtcgaccacctcgacgccgccggcggcgtgatggtcaccgccagccacaacccg
atggactacaacggcatgaagctggtgcgcgagaacgcgcgcccgatctcgtcggacacc
ggcctgttcgccatctccgacgctgccgaggccgataccgccccggccgccgcgccgacc
gccggcgagacctcgcgtaccgacaagaccgcctacatcgaacacctgctgtcctacgtg
gacgtggccacgctcaagccgctgaagctggtggtcaacgccggcaacggcggcgccggc
gccatcatcgacctgctggccccgcacctgccgctggagttcgtgcgcatcaaccacgag
ccggacggcagcttccccaacggcatcccgaacccgctgctgcccgagaaccgccaggcc
accatcgacgcggtgcgcgagcacggtgccgacttcggcatcgcctgggacggcgacttc
gaccgctgcttcttcttcgacgagcagggccgcttcatcgagggctactacctggtcggc
ctgctggcccaggcgatcctggccaagcaccccggcggcaaggtcgtgcacgacccgcgc
ctggtctggaacaccgtcgagcaggtgcaggaagccggcggcgtgccggtgctgtgcaag
agcggccacgccttcatcaaggagaagatgcgcgccgaggactgcgtctacggcggcgag
atgagcgcgcaccactacttccgcgagttcgcctacgccgactccggcatgatcccgtgg
ctgctgatcgccggccttgtctccaccagcggccgcagcctgggcgacctggtcgaggcg
cgcgtgcgcaagttcccgtgcagcggcgagatcaacttccgcgtggccgacgccaaggcc
gcggtcgcgcgggtgatggaccacttcgccgcgcagtcgccggcgctggaccacaccgac
ggcatcagcgccgacttcggcgactggcgcttcaacctgcgcagctccaataccgagccg
ctgctgcggctgaacgtggaggcgcgcggcgacgaggccctgctgaaggcgcgcaccgaa
gagatctcgcgcctgatctccgcctga

DBGET integrated database retrieval system