KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_2636Help
Entry
Psesu_2636        CDS       T01403                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psesu_2636
   00030 Pentose phosphate pathway
    Psesu_2636
   00051 Fructose and mannose metabolism
    Psesu_2636
   00052 Galactose metabolism
    Psesu_2636
  Energy metabolism
   00680 Methane metabolism
    Psesu_2636
Enzymes [BR:psu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Psesu_2636
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Psesu_2636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2887520..2888788
Genome map
AA seq 422 aa AA seqDB search
MARAKPEGTLLYAQSGGVTAVINATAAGVIAEARARGVKVLAARNGILGALREELVDTSK
ESAAAIAGLASTPGGAFGSCRYKLKSLEDDRARYERLLEVLRAHDVRYFLYNGGNDSADT
AWKVSQLAKEFDYPLACIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREAALDVAAMAE
TSTKVFVYEAMGRHAGWLAAAAGLAGKNPDEAPQIILFPERAYDEAAFLAQVEKVVKKVG
WCVVVASEGIRDKDGKFVADAGGGTDAFGHTQLGGVSSYLAGKVKDALGYKVHWTLPDYL
QRSARHIASKTDWEQAQAVGKAAVQYALKGQNAVMPVIVRSSSAPYRWKIEPAPLHKVAN
HEKTMPAGFIRKDGFGITARAREYLEPLIRGEAPLAYGRDGLPKYVTLKNTPVKKKLPAW
EG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgccaaacccgaaggcaccctgctgtacgcccagtccggcggtgttaccgcc
gtcatcaacgccaccgccgccggcgtgatcgccgaggcacgggcgcggggcgtcaaggtg
ctggccgcgcgcaacggcatcctcggcgccctgcgcgaggagctggtggacacctcgaag
gagagcgccgcggcgatcgccgggctggcctccaccccgggcggcgcgttcggctcgtgc
cgctacaagctcaagtcgctggaagacgaccgcgcccgctacgagcgcctgctggaggtg
ctgcgcgcccatgacgtgcgctactttctctacaacggcggcaacgattcggccgacacc
gcgtggaaggtctcgcagctggcgaaggagttcgattacccgctggcctgcatcggcgtg
cccaagaccatcgacaacgacctggccgtgaccgacacctgcccgggcttcggctcggcc
gccaagtacacggccgtgtcggtgcgcgaggcggcgctggacgtggcggcgatggccgag
acctcaaccaaggtgttcgtctacgaggccatgggccgccacgccggctggctggccgcc
gccgcgggcctggccggcaagaaccccgacgaggcgccgcagatcatcctgttccccgag
cgcgcctatgacgaggccgcgttcctggcgcaggtggagaaggtggtgaagaaggtcggc
tggtgcgtggtcgtggccagcgaaggcatccgcgacaaggacggcaagttcgtcgccgac
gccggtggcggcacggacgcgttcggccacacccagctgggtggcgtttcgtcctatctg
gccggcaaggtcaaggatgcgctgggctacaaggtccactggaccctgcccgactacctg
cagcgttcggcccgccacatcgccagcaagaccgactgggaacaggcgcaggcggtgggc
aaggccgcggtgcagtacgcgctcaagggccagaacgcggtgatgccggtgatcgtgcgc
agctcctcggccccgtaccgctggaagatcgagccggcgccgctgcacaaggtcgccaac
cacgagaagaccatgccggccggcttcatccgcaaggacggtttcggcatcaccgccagg
gcgcgtgaatacctggagcccctgatccgcggcgaggccccgctggcctacggccgcgac
ggcctgcccaagtacgtgaccctcaagaacacgccggtgaagaagaagctgccggcctgg
gaaggctga

DBGET integrated database retrieval system