KEGG   Pseudoxanthomonas suwonensis: Psesu_2636Help
Entry
Psesu_2636        CDS       T01403                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psesu_2636
   01230 Biosynthesis of amino acids
    Psesu_2636
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psesu_2636
   00030 Pentose phosphate pathway
    Psesu_2636
   00051 Fructose and mannose metabolism
    Psesu_2636
   00052 Galactose metabolism
    Psesu_2636
  Energy metabolism
   00680 Methane metabolism
    Psesu_2636
Enzymes [BR:psu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Psesu_2636
Protein phosphatases and associated proteins [BR:psu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Psesu_2636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2887520..2888788
Genome map
AA seq 422 aa AA seqDB search
MARAKPEGTLLYAQSGGVTAVINATAAGVIAEARARGVKVLAARNGILGALREELVDTSK
ESAAAIAGLASTPGGAFGSCRYKLKSLEDDRARYERLLEVLRAHDVRYFLYNGGNDSADT
AWKVSQLAKEFDYPLACIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREAALDVAAMAE
TSTKVFVYEAMGRHAGWLAAAAGLAGKNPDEAPQIILFPERAYDEAAFLAQVEKVVKKVG
WCVVVASEGIRDKDGKFVADAGGGTDAFGHTQLGGVSSYLAGKVKDALGYKVHWTLPDYL
QRSARHIASKTDWEQAQAVGKAAVQYALKGQNAVMPVIVRSSSAPYRWKIEPAPLHKVAN
HEKTMPAGFIRKDGFGITARAREYLEPLIRGEAPLAYGRDGLPKYVTLKNTPVKKKLPAW
EG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgccaaacccgaaggcaccctgctgtacgcccagtccggcggtgttaccgcc
gtcatcaacgccaccgccgccggcgtgatcgccgaggcacgggcgcggggcgtcaaggtg
ctggccgcgcgcaacggcatcctcggcgccctgcgcgaggagctggtggacacctcgaag
gagagcgccgcggcgatcgccgggctggcctccaccccgggcggcgcgttcggctcgtgc
cgctacaagctcaagtcgctggaagacgaccgcgcccgctacgagcgcctgctggaggtg
ctgcgcgcccatgacgtgcgctactttctctacaacggcggcaacgattcggccgacacc
gcgtggaaggtctcgcagctggcgaaggagttcgattacccgctggcctgcatcggcgtg
cccaagaccatcgacaacgacctggccgtgaccgacacctgcccgggcttcggctcggcc
gccaagtacacggccgtgtcggtgcgcgaggcggcgctggacgtggcggcgatggccgag
acctcaaccaaggtgttcgtctacgaggccatgggccgccacgccggctggctggccgcc
gccgcgggcctggccggcaagaaccccgacgaggcgccgcagatcatcctgttccccgag
cgcgcctatgacgaggccgcgttcctggcgcaggtggagaaggtggtgaagaaggtcggc
tggtgcgtggtcgtggccagcgaaggcatccgcgacaaggacggcaagttcgtcgccgac
gccggtggcggcacggacgcgttcggccacacccagctgggtggcgtttcgtcctatctg
gccggcaaggtcaaggatgcgctgggctacaaggtccactggaccctgcccgactacctg
cagcgttcggcccgccacatcgccagcaagaccgactgggaacaggcgcaggcggtgggc
aaggccgcggtgcagtacgcgctcaagggccagaacgcggtgatgccggtgatcgtgcgc
agctcctcggccccgtaccgctggaagatcgagccggcgccgctgcacaaggtcgccaac
cacgagaagaccatgccggccggcttcatccgcaaggacggtttcggcatcaccgccagg
gcgcgtgaatacctggagcccctgatccgcggcgaggccccgctggcctacggccgcgac
ggcctgcccaagtacgtgaccctcaagaacacgccggtgaagaagaagctgccggcctgg
gaaggctga

DBGET integrated database retrieval system