KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_2830Help
Entry
Psesu_2830        CDS       T01403                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00860  Porphyrin and chlorophyll metabolism
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01120  Microbial metabolism in diverse environments
Module
psu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Psesu_2830
Enzymes [BR:psu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Psesu_2830
Exosome [BR:psu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psesu_2830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADV28655
JGI: Psesu_2830
UniProt: E6WWV6
Position
3081899..3082888
Genome map
AA seq 329 aa AA seqDB search
MSYPLIRPRRMRRDEFSRRLMRENVLTTNDLIYPVFVHEEKGRSPVPSMPGVERLSIDEL
LRVAEEALELGVPVLDLFGVPDPAAKTADGRIAWDPDGIIPRAIRALKARFPELGVMTDQ
ALDPYTTHGQDGLIDESGYILNDETIEALVKQSLVHAEAGVDILSPSDMMDGRIGAIREA
LEDAGFINTRIMSYAAKYASAFYGPFRSAVGSAGNLGKGNKFTYQMDPANSDEALREVEL
DIAEGADMVMVKPGLPYLDVIRRVKDAFGVPTFAYQVSGEYAMLKAASANGWLDEKACAL
EALLAFKRAGADGVLTYYAMDVARWLRQG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatccgctgatccgcccgcgccgcatgcgccgggacgagttctcccgccgcctg
atgcgcgagaacgtgctgaccaccaacgacctgatctacccggtcttcgtccacgaggag
aagggccgcagcccggtgccctcgatgccgggcgtggagcggctgtcgatcgacgagctg
ctgcgcgtggccgaggaggcgctggagctgggcgtgccggttctggacctgttcggcgtg
cccgacccggcggccaagaccgccgatggccgcatcgcctgggacccggacggcatcatc
ccgcgcgccatccgcgccctgaaggcgcgtttccccgagctgggggtgatgaccgaccag
gccctggatccgtacaccacccacggccaggacgggctgatcgacgagtccggctacatc
ctcaacgacgagaccatcgaggcgctggtcaagcagtcgctggtgcacgccgaggccggc
gtcgacatcctctcgccctcggacatgatggacggccgcatcggcgccatccgcgaggcg
ctggaggacgcgggtttcatcaacacccggatcatgtcctatgcggccaagtacgccagc
gctttctacggcccgttccgcagcgcggtcggcagcgccggcaacctcggcaagggcaac
aagttcacctaccagatggacccggccaattcggacgaggccctgcgcgaggtcgagctg
gacatcgccgagggcgcggacatggtcatggtcaagccgggcctgccctacctggacgtg
atccggcgggtgaaggacgccttcggcgtgccgaccttcgcctaccaggtcagcggcgag
tacgcgatgctcaaggccgcttcggccaacggctggctggacgagaaggcctgcgcgctg
gaagcgctgctggcgttcaagcgtgccggcgccgacggcgtgctgacctactacgccatg
gacgtggcgcgctggctgcgccagggctga

DBGET integrated database retrieval system