KEGG   Pseudoxanthomonas suwonensis: Psesu_2899Help
Entry
Psesu_2899        CDS       T01403                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psesu_2899
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Psesu_2899
Enzymes [BR:psu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Psesu_2899
Two-component system [BR:psu02022]
 CheA family
  CheA-CheYBV
   Psesu_2899
Bacterial motility proteins [BR:psu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Psesu_2899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3150246..3150836
Genome map
AA seq 196 aa AA seqDB search
MKRRTPPLAGRYDAIVIGASAGGVAALRMLLDALPSTLPVPVLVVQHLPRDRPSQLAELF
AHGCPLPVAEAEDKSRLAPGVVWIAPPDYHLLVEDRATLALSLDEPVMFSRPAIDPLFES
AAAVFGERLLALLLTGASSDGSEGIAAVRAAGGTAWIQCPDEAASSTMPASALAHAGADE
VLTLDQIRERLRGFHP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcgcacgcccccactcgccggccgctacgacgccatcgtgatcggcgcctcc
gccggcggcgtggctgcgttgcggatgctcctcgatgccctgccctccaccctgccggtg
ccggtgctggtggtgcagcacctgccgcgcgaccgtccgagccagctcgccgagctattc
gcccatggctgcccgctgccggtggccgaggccgaggacaagtcgcggctggccccgggc
gtggtctggatcgcgccgccggactaccacctgctggtcgaggaccgcgccacgctcgcc
ctgtcgctggacgagccggtgatgttctcgcgacccgccatcgacccgctgttcgagagc
gccgccgcggtgtttggcgagcgcctgctggccctgctgctgaccggcgcatccagcgac
ggcagcgagggcatcgccgcggtgcgcgccgccggcggcaccgcctggatccagtgcccg
gatgaggcggcgtcctcgaccatgccggcatcagcccttgcccacgccggggccgacgag
gtcctgaccctcgaccagatacgcgaacgcctgcggggtttccatccatga

DBGET integrated database retrieval system