KEGG   Pseudoxanthomonas suwonensis: Psesu_2899Help
Entry
Psesu_2899        CDS       T01403                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:psu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:psu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3150246..3150836
Genome map
AA seq 196 aa AA seqDB search
MKRRTPPLAGRYDAIVIGASAGGVAALRMLLDALPSTLPVPVLVVQHLPRDRPSQLAELF
AHGCPLPVAEAEDKSRLAPGVVWIAPPDYHLLVEDRATLALSLDEPVMFSRPAIDPLFES
AAAVFGERLLALLLTGASSDGSEGIAAVRAAGGTAWIQCPDEAASSTMPASALAHAGADE
VLTLDQIRERLRGFHP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcgcacgcccccactcgccggccgctacgacgccatcgtgatcggcgcctcc
gccggcggcgtggctgcgttgcggatgctcctcgatgccctgccctccaccctgccggtg
ccggtgctggtggtgcagcacctgccgcgcgaccgtccgagccagctcgccgagctattc
gcccatggctgcccgctgccggtggccgaggccgaggacaagtcgcggctggccccgggc
gtggtctggatcgcgccgccggactaccacctgctggtcgaggaccgcgccacgctcgcc
ctgtcgctggacgagccggtgatgttctcgcgacccgccatcgacccgctgttcgagagc
gccgccgcggtgtttggcgagcgcctgctggccctgctgctgaccggcgcatccagcgac
ggcagcgagggcatcgccgcggtgcgcgccgccggcggcaccgcctggatccagtgcccg
gatgaggcggcgtcctcgaccatgccggcatcagcccttgcccacgccggggccgacgag
gtcctgaccctcgaccagatacgcgaacgcctgcggggtttccatccatga

DBGET integrated database retrieval system