KEGG   Pseudoxanthomonas suwonensis: Psesu_2912Help
Entry
Psesu_2912        CDS       T01403                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:psu00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:psu00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3169129..3171894
Genome map
AA seq 921 aa AA seqDB search
MTTESPPPARHRARRFAALLLGLATLASGLPAAAEVAPRERIRLDQGWRFHRGDPTGVDG
RLDYDARPQVQASADGKDADSRPDAAVRVQADRPVLKPWILPTANRFIRAPAQRHVPPAT
QPDVGDIPFLRAGYDDSAWPQVTLPHDWAIAGPFLADGPYGGMGRLTSWGIGWYRRQLDI
PADQRGRRIFLNLDGAMSYATVWLNGRLVGGWPYGYNSWRVDLTPYVEFGGNNTLAIRLD
NPPDSARWYPGGGLYRDVWLVSTAPVHVAQWGTTVTTPQVSAEAADVHLRVEVDNTTDRM
VKVAVESEFYELDADGRRGAAPVARIPRIGFQIVPGGSSAAASGATIARPRLWGPPPNQQ
PHRYVAVTTLRQDGQVVDRYETRFGIRQVGWDPDRGVVVNGEHIVLKGVNQHHDLGALGV
AFNVRAARRQLEILRGMGANAIRLAHNPPDPQLLELTDAMGFLVIDEIFDSWEKKKTPLD
FHLVFPEWHEADLRAMLRRDRNHPSVILWSVGNEVGEQYDGEAGAAIGRRLVQIVREEDP
TRPATASMNWAKADMPFPAAFDVINLNYQGEGIRQEPEFEGTERIRTPPSYPAFRTAFPD
KVVFGSETASALSTRGTYLFPVSAAQSAPVRDHNGGDSRRRLVSAYELHAVDFGSSADKV
FATLDRHPYVAGEFVWNGFDYLGEPTPYYESRSSYSGIIDLAGFPKDRYWLYQSRWRPEL
PMAHILPHWNWPGREGQVTPVHVFTSGDEAELFVNGISQGRKKKGAYEYRLRWDEVVYQP
GTLRVQAWRDGRPWASATVETTGAPARLALEADRSRVGNDGRDLSFITLRVLDAKGRAVP
DADTRVRFRIDGAAELVATDNGDPRDLTAFPSAERNAFGGLALAIVRGLPGRSGTARVSV
EADGLEGAVLELRVAPAVDAH
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgagtcgccgcctcctgcgcggcatcgtgcccgccgcttcgccgcgctcctg
ctgggcctggcgacgctggcgtccgggctgccggcggcggcggaagtcgcgccgcgtgaa
cgcatccgcctggaccaaggctggcgcttccaccgcggcgatccgaccggggtggacggt
cgcctggactacgacgcgcggcctcaggtgcaggcaagcgccgacggcaaggatgccgac
agcaggcccgacgcagcggtccgggtgcaggccgaccggcccgtgctcaaaccctggatc
ctgccgacggccaaccgtttcatccgcgctcccgcgcaacgccacgtgcctccggccacg
cagccggacgtcggcgacatcccgttcctgcgcgccggctacgacgactcggcctggccg
caggtcaccctgccgcacgactgggccatcgccggcccgttcctcgccgacggcccctac
ggcggcatgggccgcctgaccagctggggcattggctggtaccggcggcagctcgacatc
cccgccgaccagcgcggccgtcgcatcttcctgaacctggacggcgccatgtcctacgcc
acggtctggctcaacggccggctggttggcggctggccctatggctacaacagctggcgc
gtggacctcacgccctacgtggagttcggcggcaacaacaccttggcaatccgtctggac
aacccgcccgactcggcgcgctggtatcccggcggcggactttaccgcgacgtctggctg
gtcagcaccgcgccggtgcatgtcgcacagtggggcaccacggttaccacgccgcaggtg
tccgccgaggccgccgacgtccacctgcgggtggaagtggacaacaccaccgaccgcatg
gtgaaggtggcggtggagagcgagttctacgagctcgatgcggacggacggcgcggcgcc
gctccggtggcacgcatcccgcgcatcggcttccagatcgtgccggggggcagcagcgct
gccgcgtccggcgccacgatcgcgcggccgcggctatgggggccgccgccgaaccagcag
ccgcaccgctacgtcgccgtgaccacactgcgccaggacggacaggtggtcgaccgctac
gagacgcgcttcggcatccgccaggtcggatgggacccggaccgcggtgtggtggtcaac
ggcgagcacatcgtgctcaagggcgtgaaccagcaccacgacctcggcgcgctgggcgtg
gccttcaatgtccgcgcggcccggcgccagctggagatcctgcgcggcatgggcgccaac
gccatccgcctggcgcacaacccgcccgatccgcagctgctggaactcaccgacgcaatg
ggcttcctggtgatcgacgagatcttcgactcctgggagaagaagaagacgccgctggat
ttccacctcgtgttcccggaatggcacgaggccgacctgcgggcgatgttgcgccgcgac
cgcaaccatccttccgtgatcctgtggagcgtgggcaacgaggtcggcgagcagtacgac
ggcgaggccggcgcggccatcggccggcgccttgtgcagatcgtgcgcgaggaggatccc
acccgtccggccaccgcctcgatgaactgggccaaggccgacatgccgttccctgcggcg
ttcgacgtcatcaacctcaattaccagggcgagggcatccgccaggagccggagttcgag
ggcaccgagcgcatccgcacgccgccctcatatccggcattccgcaccgccttcccggac
aaggtggttttcggcagcgagaccgcctccgcgctgagcacgcgcggcacctacctgttc
ccggtaagcgcggcgcagagcgcgccggtgcgcgaccacaacggcggcgactcccggcgc
cgcctggtcagcgcgtacgagctgcatgcggtggatttcggctccagcgccgacaaggtg
ttcgccaccctcgaccgccatccctatgtggccggcgagttcgtgtggaacggcttcgac
tacctgggcgagcccaccccatactacgagtcgcgcagctcctacagcggcatcatcgac
ctggccggatttcccaaggaccgctactggctgtaccagtcgcgctggcgcccggaactg
ccgatggcgcacatcctgccgcactggaactggcccggccgcgagggccaggtcacgccg
gtgcacgtgttcacctccggcgacgaggccgaactgttcgtcaacggcatttcccagggc
cggaagaagaagggtgcctacgagtaccgcctgcgctgggacgaggtcgtctaccagccg
ggaacgctgcgcgtccaggcctggcgcgatggcaggccgtgggcatcggccacggtggag
accaccggcgcacccgcacgcctggcgctggaggccgaccgctcgcgagtcggcaacgac
ggccgcgacctgtccttcatcaccctgcgcgtgctcgatgccaaggggcgcgcagtgccc
gatgccgatacccgcgtgcgattccgcatcgacggcgccgcggaactggtggccaccgac
aacggcgatccgcgcgaccttaccgcttttccttcggccgaacgcaatgccttcggcggc
ctggccctggccatcgtgcgcggcctgcccggccgcagcgggactgcgcgcgtgagcgtg
gaggccgacggcctggagggcgccgtgctggagctgcgcgtggctccggccgtcgatgca
cactga

DBGET integrated database retrieval system