KEGG   Pseudoxanthomonas suwonensis: Psesu_2913Help
Entry
Psesu_2913        CDS       T01403                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
psu  Pseudoxanthomonas suwonensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3171970..3173112
Genome map
AA seq 380 aa AA seqDB search
MIRPRTALLAALALACGSALAAPKTLKDAYRDDFLLGTAVNDAIVTGEDAAQQALAVRHF
NAITLENSMKVEVLHPEPGKWDFERADAFVEFGRKHGMFLVGHTLVWHNQTPAWFFEDAG
GKPAGTEVMRERLRQYIHTVAGRYAGKVQAWDVVNEQIGEDGQYRDTTWVRAYGGDGDAL
MRDAFRFAAEAAPGTALYYNDFNAWRPEKVAGIVRMVGMLKASGIRIDGVGIQGHWGLNY
PALADIEAAIDAYHAAGVEVMVTELDVDVLPLTKEGQIIGQGMLHPQFQLPEFTRFLDPY
RDGLPGEVQQQLAARYAELFALFHRKRDKLSRVSVWGVADDMSWKNGYPIPDRTNYPLLF
DRARQPKPALDAVLKVPQGR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtccccgcaccgccctgctcgccgcgctggccctggcctgcggcagcgcgctc
gccgccccgaagacgctcaaggacgcctaccgcgacgacttcctgctgggaaccgcggtc
aacgacgccatcgtcactggcgaggacgcggcgcagcaggcgctggcggtgcggcacttc
aacgcgatcaccctggagaactcgatgaaggtcgaggtcctccatcccgaacccggcaag
tgggacttcgaacgcgccgatgccttcgtcgagttcggcaggaagcacggcatgttcctg
gtcggccacaccctggtctggcacaaccagaccccggcctggttcttcgaggacgccggc
ggcaagccggctggaaccgaggtgatgcgcgagcgcctgcgccagtacatccacaccgtg
gccgggcgctatgccggcaaggtgcaggcctgggacgtggtcaacgagcagatcggcgag
gatggccagtaccgtgacaccacctgggtgcgcgcctacggcggggacggtgatgcgctg
atgcgcgacgccttccgcttcgccgccgaggccgcgccgggtacggcgctttactacaac
gacttcaatgcctggcgcccggagaaggtcgccggcatcgtgcgcatggtcgggatgctc
aaggccagcggcatccgcatcgacggggtcggcatccagggccactggggcctcaactat
cccgcgctggccgatatcgaggcggcgatcgacgcctaccacgccgccggggtcgaggtg
atggtcaccgagctggacgtggacgtgctgccgctgacgaaggaaggccagatcatcggc
cagggcatgctgcatccgcagttccagctgccggagttcacgcgcttcctcgatccgtac
cgcgacggcctgcccggcgaggtgcagcagcaactcgccgcgcgctacgccgagctgttc
gcgctgttccaccgcaagcgcgacaagctctcgcgggtatcggtgtggggcgtggccgac
gacatgtcgtggaagaacggctatccgatccccgaccgcaccaactatccactgctgttc
gaccgcgcgcgccagcccaagcccgcgctcgatgcggtcctcaaggtgccgcagggccgg
taa

DBGET integrated database retrieval system