KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_3049Help
Entry
Psesu_3049        CDS       T01403                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:psu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Psesu_3049
Enzymes [BR:psu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Psesu_3049
DNA repair and recombination proteins [BR:psu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Psesu_3049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 UvrD_C_2 AAA_11 Helicase_RecD AAA_22 UvrD-helicase Herpes_Helicase UvrD_C AAA_28 T2SSE Mg_chelatase DUF2075 PhoH AAA_29 DEAD NTPase_1 NACHT ATPase
Motif
Other DBs
NCBI-ProteinID: ADV28872
JGI: Psesu_3049
UniProt: E6WXK6
Position
complement(3352228..3354102)
Genome map
AA seq 624 aa AA seqDB search
MSLLEDLRREGALRTLDHALALSLRRLDPSTPDAVAVAAALASLAVSAGHAGFRIDQPRA
LVDLALEWPAPAQWQAGLEASRWVARPADPADEAQGSAPLVLEDGLLYLRRYREYERRLA
AGLRRLGRGAVEPDGIDALAPLFARLFPQAAGGGDHQARAAAVALLHRLLLVTGGPGTGK
TTTIARLLVLLGARAAAAGQPAPRIALAAPTGRAAERMAESLRRAAQQLSAEGIEDGLLA
PLATTGRTLHRLLGTIPDSPRFRHHAGNPLAVDIVVVDEASMIDLPLMAKLVEAVPDGAR
LVLLGDPDQLPSVEAGDVLSGILAAAGDGMHLAASDARTLQPLLGEVEASAIEADTATPF
PARHVHLVRGWRQSAALDLAPLAAAVRVGDQARALELLREGRLDGVHYHDAVPDLLQDPA
RREHFLAHWTALADAPSPAEALALAGRLRILTAVREGPQGAAGLNRRIEALLADRLAQHQ
PRTRSDGFFHGRLLLVTENHYRHRLFNGDIGICLRDAQGQLMAWFPGEMPDAPRAFHPAA
LPAHSSAFAMTVHKAQGSEFNEVWLVLPARDSRVLSRELVYTGLTRARDSLHLCADPSIL
GTALSRHVSRVSGLAWRLGAGRSR
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctggaggacctgcgccgggaaggcgcgctgcgcaccctcgaccatgccctg
gccctgagcctgcgccggcttgaccccagcacgcccgatgccgtcgccgtcgccgcggcg
ctggcttcgctggcggtctcggccggccacgctggtttccgcatcgaccagccgcgcgcc
ctggtcgacctggccctggaatggcccgcgccggcgcagtggcaggctgggctggaagcc
tcgcgctgggtcgcccgtcccgccgatccggccgacgaggcgcagggcagcgcgccgctg
gtgctggaggacggcctgctctacctgcgccgctaccgcgaatacgagcgtcgcctggcc
gcgggcctccggcggctgggcaggggtgcggtcgagcccgacggcatcgatgcgctggcg
ccgctgttcgcgcgcctgttcccgcaggcggccggcggtggcgaccaccaggcgcgtgcc
gccgcggtcgccctgctccaccgcctgctgctggtgaccggcggccccggtaccggcaag
accaccacgatcgccaggctgctggtgctgctcggcgcacgcgccgcggccgccggacaa
ccggcgccgcgtatcgccctggccgcgcccaccggccgcgccgccgagcgcatggccgag
agcctgcgccgcgccgcgcagcagctgtccgccgaaggcatcgaggacgggttgctggca
ccgctggccaccaccggccgcaccctgcaccgcctgctcggcaccatcccggactcgccg
cgcttccgccaccacgcgggcaatccgctggccgtggacatcgtggtggtcgacgaggcc
tcgatgatcgacctgccgctgatggccaagctggtcgaggccgtgcccgatggcgcgcgc
ctggtcctgctcggcgatccggaccagctgccctcggtcgaggccggcgacgtgctcagc
ggcatcctcgccgccgccggcgacggcatgcacctggccgcatccgatgcgcgcaccctg
cagccgctgctgggcgaggtcgaggcatcggcgatcgaggcggataccgccacgcccttc
cctgcccgccacgtgcacctggtgcgcggctggcgccagtccgcggcgctggacctggca
ccgctggcggccgccgtgcgtgtcggcgaccaggcccgtgcgctggaactgctgcgcgag
ggcaggctcgatggcgtgcactaccacgacgccgtccccgacctgctgcaggatccggcg
cgacgcgagcatttcctcgcccactggaccgcgctggccgatgcgccctcgcccgccgag
gccctggccctggccggtcgcctgcgcatcctcaccgcggtgcgcgagggcccgcagggc
gcggccggactcaaccggcggatcgaggccctgctggccgaccgcctcgcccagcaccag
ccgcgcacgcgcagcgatggcttcttccacggccgcctgctgctggtcaccgagaaccac
taccgccatcgcctgttcaacggcgacatcggcatctgcctgcgcgacgcgcagggccag
ctgatggcctggttcccgggcgagatgccggacgcgccgcgcgcgttccatccggccgcc
ctgcccgcgcactccagcgccttcgccatgaccgtgcacaaggcccagggctcggagttc
aacgaggtgtggctggtgctgcccgccagggacagccgcgtgctctcgcgcgaactggtc
tacaccggcctgacgcgcgcccgcgattccctgcacctgtgcgccgatccgtcgatcctg
ggcaccgcgctgtcgcgccatgtcagccgcgtgtccggcctggcctggcggctgggggcc
ggccggagccgctag

DBGET integrated database retrieval system