KEGG   Pseudoxanthomonas suwonensis: Psesu_3049Help
Entry
Psesu_3049        CDS       T01403                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3352228..3354102)
Genome map
AA seq 624 aa AA seqDB search
MSLLEDLRREGALRTLDHALALSLRRLDPSTPDAVAVAAALASLAVSAGHAGFRIDQPRA
LVDLALEWPAPAQWQAGLEASRWVARPADPADEAQGSAPLVLEDGLLYLRRYREYERRLA
AGLRRLGRGAVEPDGIDALAPLFARLFPQAAGGGDHQARAAAVALLHRLLLVTGGPGTGK
TTTIARLLVLLGARAAAAGQPAPRIALAAPTGRAAERMAESLRRAAQQLSAEGIEDGLLA
PLATTGRTLHRLLGTIPDSPRFRHHAGNPLAVDIVVVDEASMIDLPLMAKLVEAVPDGAR
LVLLGDPDQLPSVEAGDVLSGILAAAGDGMHLAASDARTLQPLLGEVEASAIEADTATPF
PARHVHLVRGWRQSAALDLAPLAAAVRVGDQARALELLREGRLDGVHYHDAVPDLLQDPA
RREHFLAHWTALADAPSPAEALALAGRLRILTAVREGPQGAAGLNRRIEALLADRLAQHQ
PRTRSDGFFHGRLLLVTENHYRHRLFNGDIGICLRDAQGQLMAWFPGEMPDAPRAFHPAA
LPAHSSAFAMTVHKAQGSEFNEVWLVLPARDSRVLSRELVYTGLTRARDSLHLCADPSIL
GTALSRHVSRVSGLAWRLGAGRSR
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctggaggacctgcgccgggaaggcgcgctgcgcaccctcgaccatgccctg
gccctgagcctgcgccggcttgaccccagcacgcccgatgccgtcgccgtcgccgcggcg
ctggcttcgctggcggtctcggccggccacgctggtttccgcatcgaccagccgcgcgcc
ctggtcgacctggccctggaatggcccgcgccggcgcagtggcaggctgggctggaagcc
tcgcgctgggtcgcccgtcccgccgatccggccgacgaggcgcagggcagcgcgccgctg
gtgctggaggacggcctgctctacctgcgccgctaccgcgaatacgagcgtcgcctggcc
gcgggcctccggcggctgggcaggggtgcggtcgagcccgacggcatcgatgcgctggcg
ccgctgttcgcgcgcctgttcccgcaggcggccggcggtggcgaccaccaggcgcgtgcc
gccgcggtcgccctgctccaccgcctgctgctggtgaccggcggccccggtaccggcaag
accaccacgatcgccaggctgctggtgctgctcggcgcacgcgccgcggccgccggacaa
ccggcgccgcgtatcgccctggccgcgcccaccggccgcgccgccgagcgcatggccgag
agcctgcgccgcgccgcgcagcagctgtccgccgaaggcatcgaggacgggttgctggca
ccgctggccaccaccggccgcaccctgcaccgcctgctcggcaccatcccggactcgccg
cgcttccgccaccacgcgggcaatccgctggccgtggacatcgtggtggtcgacgaggcc
tcgatgatcgacctgccgctgatggccaagctggtcgaggccgtgcccgatggcgcgcgc
ctggtcctgctcggcgatccggaccagctgccctcggtcgaggccggcgacgtgctcagc
ggcatcctcgccgccgccggcgacggcatgcacctggccgcatccgatgcgcgcaccctg
cagccgctgctgggcgaggtcgaggcatcggcgatcgaggcggataccgccacgcccttc
cctgcccgccacgtgcacctggtgcgcggctggcgccagtccgcggcgctggacctggca
ccgctggcggccgccgtgcgtgtcggcgaccaggcccgtgcgctggaactgctgcgcgag
ggcaggctcgatggcgtgcactaccacgacgccgtccccgacctgctgcaggatccggcg
cgacgcgagcatttcctcgcccactggaccgcgctggccgatgcgccctcgcccgccgag
gccctggccctggccggtcgcctgcgcatcctcaccgcggtgcgcgagggcccgcagggc
gcggccggactcaaccggcggatcgaggccctgctggccgaccgcctcgcccagcaccag
ccgcgcacgcgcagcgatggcttcttccacggccgcctgctgctggtcaccgagaaccac
taccgccatcgcctgttcaacggcgacatcggcatctgcctgcgcgacgcgcagggccag
ctgatggcctggttcccgggcgagatgccggacgcgccgcgcgcgttccatccggccgcc
ctgcccgcgcactccagcgccttcgccatgaccgtgcacaaggcccagggctcggagttc
aacgaggtgtggctggtgctgcccgccagggacagccgcgtgctctcgcgcgaactggtc
tacaccggcctgacgcgcgcccgcgattccctgcacctgtgcgccgatccgtcgatcctg
ggcaccgcgctgtcgcgccatgtcagccgcgtgtccggcctggcctggcggctgggggcc
ggccggagccgctag

DBGET integrated database retrieval system