KEGG   Pseudomonas sp. VLB120: PVLB_02265Help
Entry
PVLB_02265        CDS       T02897                                 

Definition
amine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
psv  Pseudomonas sp. VLB120
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PVLB_02265
   00330 Arginine and proline metabolism
    PVLB_02265
   00340 Histidine metabolism
    PVLB_02265
   00350 Tyrosine metabolism
    PVLB_02265
   00360 Phenylalanine metabolism
    PVLB_02265
   00380 Tryptophan metabolism
    PVLB_02265
Enzymes [BR:psv01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     PVLB_02265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
522005..523777
Genome map
AA seq 590 aa AA seqDB search
MAAAWVRLCALVLIGVSSGAALAKDKTPSAIVVGGGLAGLTAAYELQNKGWQVTLLEAKS
GMGGRSGLATSEWIGNSKAQPVLNQYLDRFKLETLPAPEFVRTPGYLIDGEYFSATDLAA
KQPATAEAIKRYEKTLDDLARSIEDPLNPQATSTLFALDQINVSTWLDKLQLPTTARQLI
NQQIRTRYDEPSRLSLLYFAQQNRVYRGVSDRDLRAARLPGGSPVLAQAFVKQLKTIKTS
SPVTSIVQDKDGVTVKVGSVGYQADYLVMAVPLRALAKIQMTPGLDSQHLAALKGTNYGW
RDQLMLKFKQPVWESKARMSGEIFSNAGLGMLWIEPALKGGANVVINLSGDNARLLQAFG
DKQMVDQVLIRLHAFYPKARGSFSGYELKRYSTDANTGGAYLAYGPGQISKYWRLWERPV
QRISFAGEHTDALYPGTLEGALRSGQRAASQVQDLLAGKSFDPAKAAPVAAAAATGAVAA
KKEGGFFSRLFGGGDKPETKPAAVVKTDAVAPAPAPAPVATPAPTPVAAPAVVAKEEPAK
PAATKATPAKHAPAHKPAVKQAHKPVEAKKATVKSEPVKKAVNNTQAKAD
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgcttgggtgcgcctgtgcgcgttggtattgattggtgtgtccagcggtgcc
gcgctggcaaaggacaagacaccctcggcaatcgtggtgggtggcggcctggcaggcctg
accgccgcttacgagctgcagaacaagggctggcaggtgactctgctggaagccaagtcg
ggcatgggtggtcgctcggggctggccaccagcgagtggatcggcaacagcaaggcccag
ccggtgctgaaccagtacctggaccgtttcaagcttgaaacactgcccgcgccagagttc
gttcgtacccctggctacctgatcgacggcgagtatttcagtgccacggacctggccgcc
aagcagccggccaccgccgaagccatcaagcgctacgagaagacgctcgatgatctggcc
cgctcgatcgaggacccgctgaacccgcaggcaaccagcaccctgttcgctctggaccag
atcaacgtctccacctggctcgacaagttgcagttgccgaccactgcacgacagttgatc
aaccagcagatccgtacccgctatgacgagccgtcgcgtctgtcgctgctctacttcgca
cagcagaaccgtgtctatcgtggggtcagtgaccgcgatctgcgcgccgcccgtctgccc
gggggtagcccggtcctggcgcaggctttcgtcaagcagctcaagaccatcaaaaccagc
tcgccggtgacctccatcgtgcaggacaaggacggcgtgacggtcaaggtcggtagcgtc
ggctatcaggcggactacctggtgatggccgtgccgctgcgtgccctggccaagatccag
atgaccccaggcctggacagccagcacctggcggccctcaagggcaccaactatggctgg
cgcgaccagctgatgctcaagttcaagcagcctgtgtgggaaagcaaggcccggatgtcg
ggtgaaatcttcagcaacgctggccttggcatgctgtggatcgaaccagcgctcaagggc
ggtgccaacgtcgttatcaacttgtccggcgacaatgcccgcctgttgcaggcatttggc
gacaagcagatggtcgaccaggtactgatccggttgcacgcgttctatccaaaggcccgt
ggttcgttctctgggtatgaactcaagcgctacagcaccgacgccaacactggcggcgct
tacttggcctatggcccaggccagatcagcaagtactggcgcctgtgggagcgtccggtg
caacgcattagcttcgccggcgagcacaccgatgcattgtacccaggcactctcgaaggc
gccctgcgcagtggtcagcgtgctgccagccaggttcaggacctgctggcaggcaagtcg
ttcgacccggctaaagcggcgccggtggctgcagctgcggcaaccggtgctgtagcggcc
aagaaggagggtgggttcttctcgcgtctgtttggcggcggcgacaaacccgaaaccaaa
ccagcagccgttgtgaaaacagatgcggtggctccggccccggccccggcccctgtcgcc
acccctgcgccgacccctgtagcagcgcctgcggtcgtggccaaggaagagccggccaag
cctgccgctaccaaggccaccccggccaagcacgccccggcgcacaagccggcagtcaag
caggcgcacaaacctgtcgaggcgaagaaggctacggtcaaatcggagccggtcaagaaa
gcggtaaacaacacccaagcgaaagctgactga

DBGET integrated database retrieval system