KEGG   Pseudomonas sp. VLB120: PVLB_03680Help
Entry
PVLB_03680        CDS       T02897                                 

Definition
penicillin-binding protein 1B
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
psv  Pseudomonas sp. VLB120
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:psv00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PVLB_03680
Enzymes [BR:psv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     PVLB_03680
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     PVLB_03680
Glycosyltransferases [BR:psv01003]
 Polysaccharide
  Bacterial polysaccharide
   PVLB_03680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
840957..843278
Genome map
AA seq 773 aa AA seqDB search
MTRTRSPRTPQKRPTGRSRAWLGWALKLSLVGLVIVAGFAVYLDAVVQEKFSGKRWTIPA
KVYARPLELFVGQKLSKNDFLTELDALGYRRESAANGPGAAAVNGNNVDLNTRGFQFYEG
MEPAQFVRVRFSGDYVAGLSGANGGKLDVVRLEPLMIGGIYPKNLEDRILIKIDQVPPYL
LETLVAVEDRDFYSHFGVSPKSIARAMWVNTSSGSMRQGGSTLTQQLVKNFYLTSERSLS
RKLTEAMMAVLLELHYDKREILEAYLNEVFVGQDGQRAVHGFGLASQFFFSQPLSELKLH
QVALLVGMVKGPSYYNPRRYPERALTRRNLVLDLLAEQNVVSKEVAEAAKKMPLGVTKRG
SLADSSFPAFLDLVKRQLRQDYRDEDLTEEGLRIFTSFDPILQMKAESAMSETFKRLAGR
KGADEVESAMVVTNPETGEVQALIGSRQSGFAGFNRAIDAVRPIGSLVKPAVYLTALEQP
TKYTLTSRVQDEPFSVKGADGQVWRPQNYDRRPHGTIYLYQGLANSYNLSTAKIGLEVGV
PNVIKTIGRLGVNVDWPAFPSMLLGAGGMSPMQVATMYQTIANGGFNTPMRGIRSVLTAE
GEPLKRYPFQIQQTFDPGSIYLVQNAMQRVMREGTGRSVYSVLPSSLTLAGKTGTSNDSR
DSWFSGFSQDLLAVVWLGRDDNGKTPFTGATGALQVWTSFMRKADPLPLDMPQPDNVVQA
WIDPYSGQGSDGSCPGAVQMPYIRGSEPPAGATCGGEQDPVESVMDWVKGWMN
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgactcgaactcgatccccccgcacccctcagaaacgcccgaccggccgctcccgcgcc
tggctgggctgggctttgaagctcagcctggttggccttgtgatcgtcgccggcttcgcg
gtttacctcgatgccgtcgtccaggagaagttctctggcaagcgctggaccatcccggcc
aaggtgtatgcccggccgctggagctgttcgtcggacagaaactgagcaagaacgacttc
ctcaccgaactcgatgcgctcggctatcggcgtgagagcgccgccaacggcccaggtgcg
gccgcggtcaatggtaacaacgtcgacctcaatacccgtggcttccagttctacgagggc
atggagccggcccagttcgtgcgcgtgcgtttctccggtgactatgttgcggggctctcc
ggcgccaacggcggcaagctcgatgtggtgcgcctggagcctttgatgatcggcggtatc
tatccgaagaacctcgaagaccgcattctgatcaagatcgaccaggtgccgccgtacctg
ctcgaaaccttggtggcggtggaagaccgcgacttctacagccacttcggcgtatcgccc
aagtcgattgcccgcgccatgtgggtcaacacgtcatccggctccatgcgccagggcggc
agtaccctgacgcagcagttggtgaagaacttctacctgaccagcgagcgcagtctcagc
cgcaagctcaccgaagcgatgatggccgtgctgctggagctgcattacgacaagcgcgaa
attctcgaggcctacctcaacgaagtgttcgttggccaggacggtcaacgtgccgtgcat
ggcttcggcctggccagccagttcttcttcagccagccgctgtcggaactcaagctgcat
caggtcgccttgctggtgggtatggtcaaggggccgtcctactacaacccgcgccgttac
ccggagcgtgcgctgactcgccgtaacctggtgctcgacctgctggccgagcagaacgtg
gtgagcaaggaagtcgccgaagcggccaagaaaatgcccttgggcgtgaccaagcgtggc
agcctggccgacagctcgttcccggccttcctcgacctggtcaagcgtcagctgcgccag
gactaccgcgatgaggacttgaccgaagaaggcctgcgaatcttcaccagcttcgacccg
atcctgcagatgaaggccgagagcgccatgagcgagacgttcaagcgcctggccgggcgc
aagggcgctgatgaggtggagtcggcaatggttgtgaccaacccggaaaccggtgaggtg
caggcgctgatcggcagccgccagtcgggcttcgccggcttcaaccgcgccatcgatgcg
gtgcgtccgattggttcgctggtcaagccagcggtctacctgaccgcgctggagcaaccg
accaagtacaccctgaccagccgcgtgcaggatgagccgttttcggtcaagggcgccgac
ggccaggtatggcgtccgcagaactacgaccgccgcccccatggcaccatctacctgtat
caggggctggccaactcctacaacctgtcgaccgccaagatcggcttggaagtgggggtc
ccgaacgtcatcaagaccattgggcggctgggcgtgaatgtcgattggccagccttccca
tcgatgctgctgggcgccggtgggatgtcgccgatgcaggtcgcgaccatgtaccagacc
atcgccaatggtggcttcaataccccgatgcgcggtattcgcagcgtgctgacggccgaa
ggcgagccgctcaagcgctacccgttccagatccagcagactttcgatccgggctcgatc
tacctggtgcagaacgccatgcagcgagtgatgcgtgaaggtaccggtcgttcggtgtac
agcgtgctgccaagttcgctgaccctggcaggcaagaccgggaccagtaacgattcgcgc
gacagctggttctccggcttcagccaggacctgctggccgtggtctggctgggccgcgac
gataacggcaagacaccgttcactggcgccaccggtgccctgcaggtatggaccagcttc
atgcgcaaggccgacccgctgccgttggacatgccgcagccggacaatgtagtgcaggcc
tggatcgacccgtacagcgggcaaggttccgatggcagctgtccgggagccgtgcagatg
ccgtatattcgcgggagcgaaccgcccgcgggtgcgacctgtggcggtgagcaggatccg
gttgagtcggtcatggactgggtcaagggctggatgaattaa

DBGET integrated database retrieval system