KEGG   Pseudomonas sp. VLB120: PVLB_09850Help
Entry
PVLB_09850        CDS       T02897                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
psv  Pseudomonas sp. VLB120
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:psv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2156692..2160003
Genome map
AA seq 1103 aa AA seqDB search
MAKRSRPAAFIDDPLWYKDAVIYQLHVKSFFDANNDGIGDFPGLINKLDYIAELGVNTLW
LLPFYPSPRRDDGYDIAEYKAVHPDYGSMADAKRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARHAKRGSKARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVLKAVIGVMRFWLDMGVDGLRLDAIPYLIERDGTNNENLPETHQVLKAIRA
EIDANYPDRMLLAEANQWPEDTHPYFGEGDGDECHMAFHFPLMPRMYMALAMEDRFPITD
ILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAEDRRARINLGIRRRLAPL
LQRDRRRIELLTSLLLSMPGTPTLYYGDELGMGDNIYLGDRDGVRTPMQWSPDRNGGFSK
ADPQRLVLPPIMDPLYGYQTVNAEAQSHDPHSLLNWNRRLLAVRKQQKAFGRGTFKMLTP
SNRRILAYLREYTDANGNTEVILCVANVSRAAQAAELELSPYADMVPVEMLGGSAFPPIG
QLPFLLTLPPYAFYWFLLTSHDRMPSWHIQPSEGLPELTTLVLRKRMEELLDAPCRDTLE
TAILPQYLPKRRWYAGKEGPLDQVQLSYGVRLATATTPVLLSEIEVRSEDTVTRYQLPFG
LLPEEQITTALPQQLALSRVRRGRQVGLITDAFVLEPFIRAVLRNCEAGTRLPCTAGELR
FERTDLLAAAGLSEESQVRYLGAEQSNSSVVVADRVVLKLIRRVNAGVHPELEMSAYLAA
AGFTNISPLLAWVSRVDEQGTPHLLMIAQGYLSNQGDAWAWTQNTLERAIRDQMEPSSNT
PDAHADALAELNGFAALLGQRLGEMHLLLARPSDDPAFTPRPSDARDSKRWSEQITAELA
RALDLLAQHRDSLDADSQALVDDLQQQRDGLAQHIDNLARQAQGGLLMRVHGDLHLGQVL
VVQGDAYLIDFEGEPARPLDERRAKHSPYKDVTGVLRSFDYAAAMILRSASAVDLSDAAR
QARQRVARQYLHQSRHAFVEAYGLATAAMPHAWQQAEGERAALELFCLEKAAYEITYEAE
NRPSWLAVPLHGLHGLISTWGES
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgttcccgccctgctgccttcatcgacgacccactgtggtacaaggacgca
gtgatctaccagttgcacgtcaagtcgttcttcgacgccaacaacgatggcatcggcgat
tttcccggcctgatcaacaagctcgactacattgccgagctgggcgtcaacaccctctgg
ctgctgccattctacccgtccccccggcgcgacgacggttacgacatcgccgagtacaag
gccgtgcatcccgattacggcagcatggccgatgccaaacgcttcattgccgaggcgcac
aagcgtgggttgcgggtgattaccgagttggtcatcaaccacacctccgaccagcacccc
tggttccagcgagcccgccatgccaagcgcggcagcaaggcgcgggacttctacgtgtgg
tccgatgacgaccagaagtacgacggcacgcggatcatcttccttgacaccgaaaagtcc
aactggacctgggatccggtggccggccagtatttctggcaccgcttctactcccatcag
cccgacctcaacttcgataacccgcaggtgctcaaggcggtgatcggcgtcatgcgtttc
tggttggacatgggcgtcgatggcctacgtctggatgccattccgtacctgatcgagcgc
gatggcaccaacaacgagaacctccccgaaacccaccaggtactcaaggcgatccgcgcc
gagatcgacgccaactaccctgatcgcatgctgctggccgaggccaaccaatggccggag
gacacccacccgtacttcggcgaaggcgatggtgacgaatgccacatggcattccacttc
ccgttgatgccacgcatgtacatggccctggcgatggaggaccgttttccgatcaccgat
atcctgcgtcagacaccggagattccggccaactgccaatgggcgattttcctgcgcaac
cacgatgaactgaccctggagatggtcaccgaccgcgagcgcgactacctgtggaactac
tatgccgaggaccgccgcgcacgcatcaacctcggcatccgtcggcgcctggcgccgctg
ttgcagcgcgaccgtcggcgtatcgaactgctcaccagcctgctgctgtcgatgcccggc
acacccaccttgtattacggcgacgagctaggcatgggcgataacatctacctgggcgat
cgcgacggcgtgcgcacccccatgcaatggtcaccggaccgcaatggcggtttctccaag
gccgacccgcaacgcctggtgctaccgccgatcatggacccgctgtacggctaccagacc
gtcaacgccgaggcccagtcccacgacccgcactcgctgctcaattggaatcgccgcctg
ctggccgtccgcaaacaacagaaggcctttggtcgtggcaccttcaagatgctcacgccg
agtaaccggcggatcctggcctaccttcgcgaatacaccgacgcgaacggcaacactgaa
gtgatcctgtgcgtggccaacgtgtcgcgggctgcgcaggcggccgaactggagttgtcg
ccgtacgccgacatggtgccggtggagatgctcggcggcagcgcattcccgccgatcggc
cagttgccgttcttgctcaccttgcccccctatgcgttctactggttcttgctgacctcc
cacgaccgcatgcccagctggcacatccagccctccgaaggcctgccggagctcactacg
ctggtgttgcgcaagcgcatggaggagttgctcgacgcgccctgccgcgacaccctggaa
accgcgattctgccgcagtacctgcccaaacgccgctggtacgccggcaaggaagggcca
ctggaccaagtgcaactgagctatggcgtgcgcttggccacggccaccacgccggtgctg
ctgagcgagatcgaagttcgcagcgaagatactgtcacgcgttaccaactgccgttcggc
ctgttgcctgaagaacagatcaccaccgcgttgccccagcaactggcgctgtcccgcgta
cgccggggccgtcaggtgggactgatcaccgatgccttcgtgctcgaacccttcatccgc
gccgtgctgcgcaactgtgaggcaggcacgaggctgccctgcacggcgggcgagctacgt
ttcgaacgtaccgacttgcttgcggcagccgggctgtctgaggaaagccaggtacgctac
ctgggcgccgagcaatccaacagctcggtggtggtcgctgaccgcgtggtgctcaaactg
attcgtcgggtcaatgcaggcgtgcacccggaactggaaatgagcgcctacctcgcggct
gccgggttcaccaacatctccccgttgctggcctgggtcagccgggtggacgagcagggc
acaccgcacctgttgatgatcgcccaaggctacctgagcaaccagggcgatgcctgggcc
tggacccagaacaccctcgaacgggccatccgcgaccagatggagccttcgagcaacacc
cccgatgcccacgccgacgctctggccgaactaaacggtttcgcggccttgctcggccag
cggctgggcgagatgcacctgctgctggccaggcccagcgacgatcctgccttcacgcca
cggcccagcgatgcccgtgacagcaagcgttggagcgagcagatcacagccgaacttgcc
cgtgccctcgacctgctggcgcaacaccgcgacagcctcgatgccgacagccaggcgctg
gtcgatgacctgcagcagcaacgcgacggtctcgcccagcacatcgacaacctcgcgcgc
caggcccagggcggcttgctgatgcgcgtacacggcgacctgcacctgggtcaggtgctg
gtggtacagggcgatgcctacttgattgatttcgaaggagaacccgcccgtcctttggac
gagcggcgcgccaagcacagtccctacaaggatgtaaccggcgtgttgcgatccttcgac
tatgctgctgccatgatcctgcgcagcgcctcggcggtagacctctccgacgcggcgcgc
caggctcgtcagcgggttgcacggcagtacctgcaccagtcgcgccacgccttcgttgaa
gcctatggcctggccaccgccgcaatgccccacgcctggcaacaggctgagggcgagcgc
gccgccttggagctcttctgcctggaaaaagccgcctacgagatcacatacgaagccgaa
aaccgtccaagctggctggccgtgcctttgcatggcttgcatggactgatcagtacctgg
ggagagtcatag

DBGET integrated database retrieval system