KEGG   Pseudomonas sp. VLB120: PVLB_09855Help
Entry
PVLB_09855        CDS       T02897                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
psv  Pseudomonas sp. VLB120
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PVLB_09855
Enzymes [BR:psv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PVLB_09855
Exosome [BR:psv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PVLB_09855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2160004..2162214
Genome map
AA seq 736 aa AA seqDB search
MNATTRENGGLRQRDLDALARAEHADPFAVLGPHGDGTGGSFVRAFLPNALNARVLARHD
GQVLADMVQGSLPGLFTAHLDEAQPYLLQIGWAGGEQVTEDPYSFGPQLGDMDLYLFAEG
NHRDLSGRFGAQPTQVDGVAGVCFSVWAPNARRVSVVGDFNNWDGRRHPMRLRHSTGVWE
LFVPRIGVGETYKFEVLGKEGVLPLKADPLARATELPPSTASKVADALSHPWQDHDWMAH
RAQRHAYSAPLSIYELHAGSWRCELDDAGEIARYYNWRELAERLVPYVQELGFTHIELMP
IMEHPFGGSWGYQPLSLFAPTSRYGSAEDFAAFVDACHQGGIGVILDWVPAHFPTDEHGL
ARFDGTALYEYDNPLEGFHQDWNTLIYNLGRNEVRGFMMASALHWLKHFHIDGLRVDAVA
SMLYRDYSRKSGEWVPNRHGGRENLEAIDFIRHLNGVAAHEAPGALIIAEESTAWPGVSQ
PIQQGGLGFAYKWNMGWMHDTLHYIQNDPIHRTYHHNEMSFGLIYAYSEHFILPISHDEV
VHGKHSLIDKMPGDRWQKFANLRAYLTFMWTHPGKKLLFMGCEFGQWREWNHDDELDWYL
LQYPEHQGVQRLVSDLNRLYRNLPQLHEQDCQPQGFQWLIGDDAHNSVYAWLRWSSQGDP
LLVVANFTPVPREGYRIGVPFGERWQELLNSDAELYAGSNVGNLGAVDCEAVASHGQPVS
LSLNLPPLGVLVMRPA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaccacgcgtgaaaacggcggacttcggcaacgggacctggatgccctggcc
cgcgccgagcacgccgatccctttgcagtgctcggcccccatggcgatggaacggggggc
tcgttcgtccgcgccttcctgcccaatgcgttgaatgcacgcgtgctggcccgccatgat
gggcaagtgctcgccgatatggtgcagggtagcttgcctgggttgttcaccgcgcacttg
gatgaggcacaaccctatttgctgcaaattggttgggcaggcggcgagcaggtgaccgag
gatccctacagtttcggtccgcaactgggcgacatggacttgtacctgtttgccgagggc
aaccaccgggatctgtccggccgcttcggtgcccagccgacgcaggtcgatggtgtcgct
ggcgtctgcttctcggtgtgggcgccgaacgcccgtcgtgtgtcggtcgtgggcgacttc
aacaactgggacggtcgccgccatcccatgcgcctgcgccacagtacgggtgtctgggaa
ttgttcgtgccccgcatcggtgtcggcgagacatacaagttcgaggtattgggcaaggaa
ggggtgctgccactgaaggccgacccactggcccgcgccaccgaactgccgcccagtacc
gcctccaaggtcgctgatgcgctcagtcacccatggcaggatcacgactggatggcacac
cgtgcccagcgtcacgcctacagtgcgccgctgtcgatctacgagctgcacgcaggctcc
tggcgctgcgagttggacgatgccggtgaaatcgcgcgctattacaactggcgcgaactg
gccgagcggctggtgccctatgtacaggaacttggcttcacccatatcgagctgatgccg
atcatggagcacccgttcggtggctcatggggctaccagccgctttcgctgttcgcgccc
acctcgcgttacggcagcgccgaagatttcgcggcattcgtcgatgcctgccaccagggt
ggcattggcgtgatactcgactgggtgcctgcgcatttccccaccgatgaacacggcctg
gcccgcttcgacggcacggcactttacgagtacgacaatcccctggaaggcttccaccag
gactggaacacccttatctacaaccttggtcgcaacgaagtacgcggcttcatgatggcc
tcggcgctgcactggctcaaacacttccacatcgacggcctgcgggtcgatgcggtggct
tcgatgctgtaccgcgactactcgcgcaagtcgggtgagtgggtgcccaaccgccatggt
gggcgcgagaacctcgaagccatcgacttcatccgccacctcaacggcgttgccgcccat
gaagcgcccggtgcgctgatcatcgccgaggaatccactgcctggcccggcgtcagccag
ccgatccagcaaggcggcctgggctttgcttacaagtggaacatgggctggatgcacgac
acgctgcattacatccagaacgacccgatccaccgcacgtaccaccacaacgagatgagt
ttcgggctgatctatgcctattccgagcatttcatcctgccgatttcccacgatgaagtg
gtgcatggcaagcattcgctgatcgacaagatgcccggcgatcgctggcagaaattcgcc
aacctgcgcgcctacctcaccttcatgtggacccaccccggcaagaagttgctgttcatg
ggctgcgagttcggccaatggcgcgaatggaatcacgacgacgagttggactggtacctg
ctgcagtaccccgagcaccagggtgtgcagcgcctggtgagtgaccttaaccggctgtac
cgcaacctgccgcaattgcatgagcaggactgccagccgcagggcttccagtggttgatc
ggcgatgatgcgcacaacagcgtgtatgcctggctgcgctggagcagccaaggtgatccg
ctgctggtagtggctaacttcaccccggtgccgcgtgagggctacaggattggtgtgccg
ttcggtgaacgctggcaagagctgctcaacagcgatgccgagctgtatgccgggtcgaat
gtgggtaacctgggcgcagtggactgtgaggcggtggccagtcatgggcaaccggtgtcg
ctgtcgctgaatttgccgccgttgggggtgttggtgatgaggcccgcgtaa

DBGET integrated database retrieval system