KEGG   Pseudomonas sp. VLB120: PVLB_15265Help
Entry
PVLB_15265        CDS       T02897                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
psv  Pseudomonas sp. VLB120
Pathway
psv00220  Arginine biosynthesis
psv00250  Alanine, aspartate and glutamate metabolism
psv00471  D-Glutamine and D-glutamate metabolism
psv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PVLB_15265
   00220 Arginine biosynthesis
    PVLB_15265
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PVLB_15265
Enzymes [BR:psv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PVLB_15265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase CCD
Motif
Other DBs
NCBI-ProteinID: AGZ35837
UniProt: U5VG53
Position
3344878..3345786
Genome map
AA seq 302 aa AA seqDB search
MQTLLNEILDEVRPLIGKGKVADYIPALADVPAQQLGIAVYGNDGSYYCAGDALVPFSVQ
SISKVFSLVQAIGHSGEAIWERLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDI
NQSRFAAPTLSMRDFVRRLSGNPRIAIDARVADSEYQFRARNAAMAYLMQSFGNFHNEVE
TVLRSYFSYCALQMSCLDLARAFCFLANDGFCKHSGEQILTRRQTQQVNSIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAIVPGQFTVCVWSPELNTAGNSYAGMAALELLSSRIGWS
VF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgctgttgaacgagattctcgacgaagtgcgtcccttgatcggcaagggcaaa
gtggctgactacattcccgcgctggccgatgtgcctgcgcagcagttgggcatcgccgtc
tatggcaacgatggcagctattactgcgcaggtgacgccctggtgccgttttcggtgcag
agtatttccaaggtgttcagtctggtccaggcgattggccattcaggtgaagccatctgg
gagcgtcttggccatgagccctcaggtcaaccgttcaactcgctggtacagctggagttc
gaacgcgggcgcccacgcaaccccttcatcaatgcgggcgcgttggtgatctgcgatatc
aatcagtcgcgcttcgccgcgcccaccttgtcgatgcgcgacttcgtacggcggctatcg
ggcaacccccgtatcgccatcgatgcccgcgtcgcggattcggagtaccagttccgcgcg
cgcaacgccgccatggcgtacctgatgcagtcatttggcaacttccataacgaagtcgag
acggtgctgcgcagttacttcagttactgcgcactgcagatgagctgcctcgacctggcc
cgtgccttctgcttcctggccaacgatgggttctgcaagcacagtggcgagcaaatcctg
acccgacgccagacccagcaggtgaactcgatcatggccaccagcgggctgtacgacgaa
gcggggaatttcgcctaccgcgtgggcttgcctggcaagagtggcgtaggtggcggaata
gtggcgatcgtgccgggtcaattcaccgtttgcgtgtggtcgccggagttgaatacggcg
ggcaactcgtatgccgggatggcggcgctcgagttgctcagttcacggatcggatggtcg
gtgttctga

DBGET integrated database retrieval system