KEGG   Pseudomonas sp. VLB120: PVLB_15735Help
Entry
PVLB_15735        CDS       T02897                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
psv  Pseudomonas sp. VLB120
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:psv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PVLB_15735
Enzymes [BR:psv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PVLB_15735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3443582..3444487)
Genome map
AA seq 301 aa AA seqDB search
MKAKVVVVGSLNMDLVARAERLPRPGETLAGETFFTVPGGKGANQAVAVARLGGTVAMVG
NVGDDAYGQQLRQALEVEGIDCQAVKVCEGVSSGVALITVDAASQNCIVIIPGGNGLLTP
QAVQQFDGLLQAAEVIICQLEVPADTVAWTLARGRELGKTVILNPAPATGPLPTQWLAHI
DYLAPNESEAQALTGVPVSDLDSARRAGERLVQLGVRKVIITLGAHGALLVCAQGSRHFP
APKVKALDTTAAGDTFIGGFAAALVRGLTEDAAIAFGQRAAALSVTRAGAQPSIPYLKEL
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccaaggtagtggtggtcggtagcctcaacatggacctggtggcccgcgccgaa
cgcctgccgcgtccgggcgaaacgctggccggcgaaacctttttcaccgtgcctgggggc
aaaggtgccaatcaggcggtggccgtcgcccgactgggcggcactgtggcgatggtcggc
aacgttggcgatgacgcctatggccagcagctgcgccaagcgctggaggtcgaaggtatc
gactgccaggcagtcaaggtatgcgagggcgtttccagcggcgtggcgctgattaccgtg
gatgccgccagccagaactgcatcgtcatcattcccggtggcaacggcctgctgacgcca
caggccgtgcagcagttcgatgggttgttgcaggcggccgaagtgatcatctgccagctc
gaggtgccggccgacaccgtggcctggaccctggcccgggggcgtgagcttggcaagacc
gtgattctcaaccccgcgccggccaccggccctttgccgacacaatggctggcccacatc
gattacctcgccccgaacgaaagcgaggcccaagcgctgaccggcgtgccagtcagcgac
ctcgacagcgcccggcgtgcgggtgagcgcctggtgcaactgggggtgcgcaaggtgatc
atcacgctgggcgcgcacggggccctgctggtttgcgcgcaaggcagccggcacttcccc
gcgcccaaggtcaaggcgttggataccaccgccgccggcgataccttcattggcgggttc
gccgccgcgctggtgcgtggcctgacggaggatgccgccatcgctttcggccaacgcgcc
gcagcgctgtccgttacccgcgcgggtgcgcagccgtccatcccgtacctcaaggagctg
ccatga

DBGET integrated database retrieval system