KEGG   Pseudomonas sp. VLB120: PVLB_22535Help
Entry
PVLB_22535        CDS       T02897                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
psv  Pseudomonas sp. VLB120
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psv00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PVLB_22535
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PVLB_22535
   00310 Lysine degradation
    PVLB_22535
Enzymes [BR:psv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PVLB_22535
    2.6.1.48  5-aminovalerate transaminase
     PVLB_22535
Amino acid related enzymes [BR:psv01007]
 Aminotransferase (transaminase)
  Class III
   PVLB_22535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4972875..4974152)
Genome map
AA seq 425 aa AA seqDB search
MNTNQSLQQRRLAAIPRGVGQIHQIYAERAENATVWDVEGREYLDFAGGIAVLNTGHLHP
KVMAAVQAQLAKLTHTCFHVFGYEPYVALAEKINQRVPGDFEKKTLLVTTGAEAVENAIK
IARAATGRQGVIAFTGAYHGRTHYTLSLTGKVVPYSAGMGLMPGGIYRAQYPNAVHGVSS
DDAIASVERIFKNDAAPTDIAAIILEPVQGEGGFNVAPKDFLARLRALCDEHGIVLIADE
VQTGAGRTGTFFAMEQLGVAADLTTFAKSIAGGFPLAGVCGRAEIMDAVAPGGLGGTYAG
SPVSCAAALAVLEAFDDEKLLERAQAVGEILTSGLRAIGERHNSLVDVRNLGAMVAVELF
EGGDLSKPAADLTAKVVAKARDKGLILLSCGTYYNVLRILVPLTVSDADLQRGLALIGEC
FDELA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaaccagagcctgcaacaacgccgcctggccgccattccacgtggcgtcggg
caaatccaccagatctacgccgagcgtgccgagaacgccaccgtgtgggacgtcgagggc
cgagagtacctggacttcgccggcggtatcgcggtgctcaataccggccacctgcacccg
aaagtcatggcagccgtccaggcgcagctggccaagctgacccacacctgcttccacgtc
tttggctacgagccctacgtggccctggccgagaagatcaaccagcgcgtgccgggcgac
ttcgagaaaaagaccttgctggtgaccaccggcgccgaagcggtggagaacgccatcaag
atcgcccgtgccgccactggccgccagggtgtgatcgccttcaccggcgcctaccatggg
cgtacgcactacaccctgagcctgaccggcaaggtcgtgccgtactctgcgggcatgggc
ctgatgccaggtggcatctaccgtgcccagtacccgaacgcggtgcatggcgtgagcagc
gatgacgccatcgccagcgtcgaacgcatcttcaagaacgacgccgcgccgactgacatc
gccgcgatcattctcgaaccggtccagggcgaaggtggtttcaacgtcgcgccgaaagac
ttcctggcccgtctgcgcgccctgtgcgacgagcacggcatcgtgctgatcgccgacgaa
gtgcagaccggtgctggtcgtaccggtaccttcttcgccatggagcaactgggcgtcgcc
gccgacctgaccaccttcgccaagtccatcgccggtggtttcccgctggctggtgtgtgc
ggccgtgccgagatcatggatgcggtggctcccggtggcctgggcgggacctacgccggt
agcccagtctcctgcgccgctgccctggccgtgctggaagccttcgacgacgagaaactg
ctggagcgggcccaggcggtcggtgaaatcctcaccagcggcctgcgcgccatcggcgag
cgtcacaacagcctggtggatgtgcgcaacctgggtgccatggtcgccgtagagttgttc
gagggcggtgacctgagcaagcctgcggccgatctgactgccaaggtggtggccaaggcc
cgtgacaaagggctgatcctgctgtcgtgcggcacctattacaacgtcttgcgcattttg
gttccgctgaccgtcagcgacgcggacttgcagcgcggtctggccttgatcggcgagtgc
ttcgacgagctcgcctga

DBGET integrated database retrieval system