KEGG   Psychromonas sp. CNPT3: PCNPT3_00600Help
Entry
PCNPT3_00600      CDS       T02515                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
psy  Psychromonas sp. CNPT3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:psy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149758..150498
Genome map
AA seq 246 aa AA seqDB search
MFIAIMLKPRLLITRFEPHASRLVKLLNEQGVFSLAQPLLEVQSSAECHDVDLIFVTRYD
YIIAISAAAVKYTEQALDKKAWPTATFIAVGKRTQKMLQQATQKEVQCPPLQHDTQGLLA
LACLNCVQGKKILILRGVGGRAKLKKTLESRGAEVSYYQPYQRVVIDLNMDELVENWQLH
KINGAIISSIELLENFTTRVRDKHWLYELHLYVPSQRILDRALQLGWVKIVLLASLADQQ
IIDHFK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtttatcgcgataatgcttaaaccgcgactattgataacgcgctttgaaccacatgcc
tcgcgtctggttaaattgcttaatgagcaaggtgtttttagccttgctcagccgttatta
gaagtacaaagtagcgcggaatgtcatgatgtagatctgatttttgtcacacgttatgac
tatattattgccattagtgcggcggcggttaaatatacagagcaagctttagataaaaaa
gcctggccaacagcaacttttattgcggtgggtaaacgaactcaaaaaatgttacaacaa
gcaacccaaaaagaggtgcagtgcccacccttgcaacatgatacgcaaggcttactggcg
ttagcgtgtctcaattgcgtgcaaggtaaaaaaatactgatattacgtggtgttggtggc
cgcgctaaattaaagaaaacattagagtcgcgtggtgcagaggtctcttattatcaacct
taccaacgcgttgtaatagatctcaacatggatgaattagttgaaaattggcagttgcat
aaaattaatggtgctattatcagcagtatcgaattattagaaaattttacaacacgtgtg
cgtgataaacactggttatatgaattgcacttatacgtgcctagccaacgcattttagat
cgcgccttgcaattgggttgggtaaagatagttttattagcaagtcttgctgatcaacaa
attattgatcattttaaataa

DBGET integrated database retrieval system