KEGG   Psychromonas sp. CNPT3: PCNPT3_02305Help
Entry
PCNPT3_02305      CDS       T02515                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psy  Psychromonas sp. CNPT3
Brite
Enzymes [BR:psy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PCNPT3_02305
Secretion system [BR:psy02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PCNPT3_02305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
543283..544017
Genome map
AA seq 244 aa AA seqDB search
MFFSFLKKRLLVSLSLLLVSTFSFAESKVDAQSVASISKKMQQISLQVTSIKESKVEGLY
EVLTNSGIYYVSKNAQYLIYGSIYDIDNNMKNITESSLASLRQNKLKAFSNDMITYKAAN
EKHVITVFTDTSCAYCQKLHSEIADYNKLGITVRYLAFPRAGLNSSEYNIMTSIWCASDP
KSAMDKAMKRQSLDPKQCANTIKEQYELGLFFGVRGTPAIVLEDGSLKPGYLPATKLLQQ
LEGK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtttttttcttttcttaaaaaacgtttgttagtcagtttaagtttgctacttgtatca
acgttctcttttgctgagtctaaagttgatgcgcaaagtgtggcgagtatcagtaaaaag
atgcaacagatctcgttacaggtgaccagtattaaagagtcaaaggttgaaggcttgtat
gaagtattaaccaatagtgggatttattatgtgagtaaaaatgctcaatatctcatttat
ggtagtatttatgatatcgataataatatgaaaaatattacagaaagtagcttggcgtca
ttaagacagaataagttaaaggcattttctaatgacatgatcacttataaagctgcaaat
gaaaaacatgtgatcactgtttttactgatacttcttgtgcttattgtcaaaaacttcat
tcggagattgccgattataataaattaggcatcaccgtgcgttatttggctttccctcgt
gcaggtttaaattcgtcagaatataatataatgacctctatttggtgtgcgagcgatcct
aaatcagcaatggataaagcgatgaaacgccaatctcttgatccgaagcaatgtgcgaat
acgatcaaagagcaatatgaacttggtttgttttttggtgtccgtggtactcccgccatt
gtattagaagatggctcattaaaaccgggttatttaccggctacgaagttattacaacag
ttagagggtaaataa

DBGET integrated database retrieval system