KEGG   Psychromonas sp. CNPT3: PCNPT3_07380Help
Entry
PCNPT3_07380      CDS       T02515                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
psy  Psychromonas sp. CNPT3
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:psy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PCNPT3_07380
  Amino acid metabolism
   00340 Histidine metabolism
    PCNPT3_07380
Enzymes [BR:psy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PCNPT3_07380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1750860..1752185
Genome map
AA seq 441 aa AA seqDB search
MQNKMKIVCWSDLDEQAQQKIMRRPALNDNAQLCNEVSAIIETVQKAGDSALVNYSARFD
NYALKNIKITKQEINQAPQRLSTNIKEAIQSAHQQVLKFHQAQQTQTIRVQTLPGVICEM
HTHAIESVGLYIPGGSAPLPSTVIMTATPAQIAGCTRVVLCSPPPIADEILYAAMLCGVD
EIYRVGGAQAIAALAYGTSSIARVDKIFGPGNAYVTEAKRQVNHDLAGASIDMPAGPSEV
LIIADKDADPTFIAADLLSQAEHGHDSQVILLTPSLDIAQQTLAAIDAQLLSLPRRAIAE
KALANSVCIICDDIAQALQISERYAPEHLIVQCNNARDLLPKLKNAGSIFLGKWTPEAVG
DYASGTNHVLPTYGAARTYSSLGLADFVRRFSVQQVTPQGLRNLAPTVTCLASAEGLDAH
RRAVTIRLDKLSAKGEFDEKD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataaaatgaaaattgtgtgttggtctgacttagatgagcaagcacagcaaaaa
atcatgcgacgccctgcacttaatgataacgcgcaactttgcaatgaggtcagcgccatc
atcgaaaccgtccaaaaagccggtgatagcgcgttagttaactacagcgcgcgctttgat
aactacgcattaaaaaatatcaaaataacgaaacaggagataaaccaagcgccacaacgt
ctgagcactaatataaaagaggccattcaaagtgcccaccagcaagtgttaaaatttcat
caagcccaacaaacacagactattcgtgtacaaacattacctggggttatctgtgagatg
cacacccacgccattgaatcagtcggattatatatccccggtggcagtgcgcccttaccc
tcgacagtgatcatgaccgcaacccctgctcaaattgccggctgcacgcgcgttgtttta
tgctctccaccgccgattgcagatgaaattttatatgcagctatgctttgtggcgtcgat
gaaatttaccgcgtgggtggcgcgcaggccatagcagcactcgcttatggcacgtcatca
atcgcccgcgtcgataaaatatttggccccggcaatgcttatgtcaccgaagctaaacgc
caagtaaaccatgatttagcgggcgcgagcattgatatgccagcaggcccctcagaggta
cttatcattgccgataaagatgccgatcccacgtttattgcggccgaccttttatcacaa
gccgagcatggtcacgactcacaagttattttactcactcccagtttagacattgcgcag
caaacattagcagccattgacgcgcaacttttaagcttgccgcgccgtgctattgcagaa
aaagcgctggcaaacagcgtgtgtattatttgtgatgatattgcccaagcgctacaaatt
tctgagcgctacgcccctgagcacttaatagtgcaatgcaataatgcgcgcgatttactg
cccaagcttaaaaatgcaggatctatctttttaggtaaatggacgccagaagcagtcggc
gattatgccagtgggactaaccatgtgctaccgacttacggggctgcgcgtacctattca
agtttaggactcgctgattttgtaaggcgttttagcgtgcaacaggtgacgcctcaagga
ttacgcaatctcgcccccactgttacctgccttgcaagcgctgagggtttagatgcccat
aggcgcgcggtgactattcgtcttgataaattatccgccaaaggagaatttgatgaaaag
gattaa

DBGET integrated database retrieval system