KEGG   Psychromonas sp. CNPT3: PCNPT3_07380Help
Entry
PCNPT3_07380      CDS       T02515                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
psy  Psychromonas sp. CNPT3
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psy01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:psy00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1750860..1752185
Genome map
AA seq 441 aa AA seqDB search
MQNKMKIVCWSDLDEQAQQKIMRRPALNDNAQLCNEVSAIIETVQKAGDSALVNYSARFD
NYALKNIKITKQEINQAPQRLSTNIKEAIQSAHQQVLKFHQAQQTQTIRVQTLPGVICEM
HTHAIESVGLYIPGGSAPLPSTVIMTATPAQIAGCTRVVLCSPPPIADEILYAAMLCGVD
EIYRVGGAQAIAALAYGTSSIARVDKIFGPGNAYVTEAKRQVNHDLAGASIDMPAGPSEV
LIIADKDADPTFIAADLLSQAEHGHDSQVILLTPSLDIAQQTLAAIDAQLLSLPRRAIAE
KALANSVCIICDDIAQALQISERYAPEHLIVQCNNARDLLPKLKNAGSIFLGKWTPEAVG
DYASGTNHVLPTYGAARTYSSLGLADFVRRFSVQQVTPQGLRNLAPTVTCLASAEGLDAH
RRAVTIRLDKLSAKGEFDEKD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataaaatgaaaattgtgtgttggtctgacttagatgagcaagcacagcaaaaa
atcatgcgacgccctgcacttaatgataacgcgcaactttgcaatgaggtcagcgccatc
atcgaaaccgtccaaaaagccggtgatagcgcgttagttaactacagcgcgcgctttgat
aactacgcattaaaaaatatcaaaataacgaaacaggagataaaccaagcgccacaacgt
ctgagcactaatataaaagaggccattcaaagtgcccaccagcaagtgttaaaatttcat
caagcccaacaaacacagactattcgtgtacaaacattacctggggttatctgtgagatg
cacacccacgccattgaatcagtcggattatatatccccggtggcagtgcgcccttaccc
tcgacagtgatcatgaccgcaacccctgctcaaattgccggctgcacgcgcgttgtttta
tgctctccaccgccgattgcagatgaaattttatatgcagctatgctttgtggcgtcgat
gaaatttaccgcgtgggtggcgcgcaggccatagcagcactcgcttatggcacgtcatca
atcgcccgcgtcgataaaatatttggccccggcaatgcttatgtcaccgaagctaaacgc
caagtaaaccatgatttagcgggcgcgagcattgatatgccagcaggcccctcagaggta
cttatcattgccgataaagatgccgatcccacgtttattgcggccgaccttttatcacaa
gccgagcatggtcacgactcacaagttattttactcactcccagtttagacattgcgcag
caaacattagcagccattgacgcgcaacttttaagcttgccgcgccgtgctattgcagaa
aaagcgctggcaaacagcgtgtgtattatttgtgatgatattgcccaagcgctacaaatt
tctgagcgctacgcccctgagcacttaatagtgcaatgcaataatgcgcgcgatttactg
cccaagcttaaaaatgcaggatctatctttttaggtaaatggacgccagaagcagtcggc
gattatgccagtgggactaaccatgtgctaccgacttacggggctgcgcgtacctattca
agtttaggactcgctgattttgtaaggcgttttagcgtgcaacaggtgacgcctcaagga
ttacgcaatctcgcccccactgttacctgccttgcaagcgctgagggtttagatgcccat
aggcgcgcggtgactattcgtcttgataaattatccgccaaaggagaatttgatgaaaag
gattaa

DBGET integrated database retrieval system