KEGG   Psychromonas sp. CNPT3: PCNPT3_08170Help
Entry
PCNPT3_08170      CDS       T02515                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
psy  Psychromonas sp. CNPT3
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psy00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    PCNPT3_08170
   01230 Biosynthesis of amino acids
    PCNPT3_08170
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PCNPT3_08170
   00290 Valine, leucine and isoleucine biosynthesis
    PCNPT3_08170
Enzymes [BR:psy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PCNPT3_08170
    2.6.1.66  valine---pyruvate transaminase
     PCNPT3_08170
Amino acid related enzymes [BR:psy01007]
 Aminotransferase (transaminase)
  Class I
   PCNPT3_08170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928040..1929254
Genome map
AA seq 404 aa AA seqDB search
MYRVEKSHKLDNVCYDIRGPVLKQAQKLEDEGQRILKLNIGNPASFGFEAPEEVLMDVIK
HLPQSQGYCDSKGLFSARKAVMQHYQEKGLLSLDIDDIYIGNGVSELIVMSMQALLNNGD
ELLIPSPDYPLWTAATHLSGGKAVHYICDEQAGWFPDIDDIKSKITSRTKGIVLINPNNP
TGAVYSKELLEQIIELARQHNLIVFSDEIYSKIVYDDAKHIPLATLADDILIVTFDGLSK
AYRVCGFRVGWMMISGLKRQAQDYIAGLEILASMRLCANVPMQHAIQTSLGGYQSINELI
IPGGRLYDQTQGAWKLLNEIPGVSCTKPNGSLYLFPKLDQKRFNIKDDQRFVMDLLMEKK
ILVVQGTGFNWASPDHFRIVCLPHMDELSTAIHRIGDFLETYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgttgaaaagtcccataaattagataatgtttgttatgacattcggggccct
gtccttaaacaagctcaaaagttagaagatgagggccaacggatcctcaaattaaacata
ggcaatccggcctcttttggctttgaagcacccgaagaagtattaatggatgtgatcaaa
catcttcctcaaagccaaggatattgtgacagcaaaggtttattttctgcgcgcaaagcg
gtgatgcagcattaccaagaaaaaggcttattatcactcgatatcgacgatatctatatt
ggtaatggggtcagtgaattgattgttatgtcgatgcaggccttgcttaataacggcgat
gaactgttaataccctctcctgattaccctttatggacagcggccacccatctttctggt
ggtaaagcggtgcactacatttgtgatgaacaagcgggatggtttcctgacattgatgat
atcaaatcgaaaatcacatctagaaccaaagggattgtgttaattaatcccaataaccca
acgggtgcggtttactctaaagagttacttgagcaaattattgagcttgcaagacagcat
aatttaattgtattttccgatgagatttactctaaaattgtctatgacgatgctaaacat
atccctttagcaacgctcgctgatgatattttaattgtgacctttgatggcctttctaaa
gcttaccgcgtgtgtgggtttcgtgttggctggatgatgataagtgggcttaagcgccaa
gcacaagattatatagcaggacttgagatccttgcaagtatgcgcctgtgtgccaacgta
cccatgcagcatgctatccaaacatcccttggtggctatcaaagtattaatgagttgatt
attcctggtggacgtttgtatgatcaaacccaaggtgcttggaagttattgaatgagatc
cctggcgtaagttgtactaaacccaatggatcgttatatctttttcctaaattagaccaa
aaacgttttaacattaaagacgaccaacgttttgttatggacttattaatggagaaaaaa
atattagtcgtacaaggcaccggttttaactgggcaagcccagatcatttccgaattgtg
tgcttaccgcatatggatgagctaagcaccgctatccatcgtattggtgatttcctcgag
acttatcgccaataa

DBGET integrated database retrieval system