KEGG   Psychromonas sp. CNPT3: PCNPT3_10990Help
Entry
PCNPT3_10990      CDS       T02515                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
psy  Psychromonas sp. CNPT3
Pathway
psy00240  Pyrimidine metabolism
psy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PCNPT3_10990
Enzymes [BR:psy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PCNPT3_10990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AGH82134
UniProt: M4U796
Position
2586622..2587959
Genome map
AA seq 445 aa AA seqDB search
MILLPQEIIRSKRDGKTLSKQEIDYFIQGVTNNSVTESQIAAFAMAVYFQDMTMDERVLL
VSAMRDSGMTIDWTNLHLDGPVVDKHSTGGVGDVTSLMLGPMIAACGGYVPMISGRGLGH
TGGTLDKLDAIPGYQTTPESTDQFLKIVKEVGVAIIAQTGDLAPADKRIYATRDITATVE
SIPLITASILSKKLASGLESLVMDVKAGSGAFMPTFEKSEELAKSIVATANGAGCKTTAL
ITNMNQVLASSAGNALEVREAVQFLTGEYVNPRLHEVTMALCSEMLQLSGLATDVDDAQK
KLQAVLDNGKAAEVFGKMVSALGGPTDFVENYDTYLQKSAIIRPVYALQSGFVQSMDTRA
IGMAVVSMGGGRMKSSDSIDYAVGFNQFISLGDEVTKDKPLAMIHVQNEAQFSDAERAIQ
HAIMCGDKKLPTETQVYSRIRLDDI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgatattactacctcaagaaatcattcgcagtaaacgtgatggaaaaaccttaagcaaa
caagaaatagactattttattcaaggcgtcaccaataacagcgtcacagaaagtcaaatt
gcagcctttgcgatggccgtatatttccaagatatgaccatggacgaacgtgttctatta
gtctctgcgatgcgcgactcgggtatgaccatagattggacaaatttacatttagatgga
ccggttgttgataaacattcaacgggcggtgtgggtgatgttacctcgttaatgcttggt
cctatgattgcagcctgtggcggttatgtaccgatgatatcaggtcgaggtttaggtcat
acaggcggcactttagataagctagatgctatcccgggttatcaaactacccctgaaagt
accgaccaatttcttaaaattgtaaaagaagtgggtgtggctattattgcgcaaaccggc
gacttagcaccagcagacaagcgtatttatgcaacacgtgatattacggcaacggttgag
tctattcccttgatcaccgcatctattttatcaaaaaaattagcatctggccttgagtca
ctggttatggatgtaaaagcgggcagtggcgcatttatgcctacctttgaaaaatcagaa
gaattagcgaaaagcattgtggcaacggccaatggtgcgggttgtaaaaccaccgcatta
attaccaatatgaatcaagtactcgcaagctctgcaggtaatgcgcttgaagtacgcgaa
gcggtacaatttttaacgggtgaatacgtaaaccctcgtttacatgaagtcaccatggcg
ctgtgctctgaaatgttacaactcagtggccttgcgacagacgttgacgatgcacagaaa
aaactacaagcggtactcgataatggtaaagcggctgaagtctttggtaaaatggtcagc
gcattaggcggaccgactgattttgttgaaaattacgatacttacttacaaaaatcagcc
attattcgccctgtttatgcattacaaagtggctttgtacaaagcatggatacccgcgct
atcggtatggcggttgtgagtatgggcggtggtcgcatgaagtcatctgacagtattgat
tatgccgttggttttaaccaatttatctcgttaggtgatgaggttacaaaagacaaacca
ttagcgatgatccacgtacaaaatgaagcacagtttagtgatgcagagcgcgcaatacaa
cacgctataatgtgtggtgataaaaaactaccgacagaaacacaagtctattcgcgcatc
cgcttagacgatatataa

DBGET integrated database retrieval system