KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_1773Help
Entry
DABAL43B_1773     CDS       T04748                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:psyc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DABAL43B_1773
   00630 Glyoxylate and dicarboxylate metabolism
    DABAL43B_1773
   00640 Propanoate metabolism
    DABAL43B_1773
   00650 Butanoate metabolism
    DABAL43B_1773
  Lipid metabolism
   00071 Fatty acid degradation
    DABAL43B_1773
   00072 Synthesis and degradation of ketone bodies
    DABAL43B_1773
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DABAL43B_1773
   00310 Lysine degradation
    DABAL43B_1773
   00380 Tryptophan metabolism
    DABAL43B_1773
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DABAL43B_1773
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DABAL43B_1773
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DABAL43B_1773
Enzymes [BR:psyc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DABAL43B_1773
Exosome [BR:psyc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DABAL43B_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:2053242..2054888
Genome map
AA seq 548 aa AA seqDB search
MSNKNNHPDSPVVEATVVKATDAKSTDTAADKAATDTKKADTKATDSKVASPKKETPANT
SKSTPAKGDTVAKDGAAKESNEKANNDKDSTDKKDADKKVEATTAKKTTTAAKKASTTKL
SSGQHRVAILGGNRIPFARSNGSYADVSNTDMLTAALDGLIERYNLQDEKIGEVVAGAVM
KLSRDINLTREAALNTALNPHTPTYDISQACGTGLQATFASANKIALGIIDSAITGGVDT
TSDAPIAVGDGLRKVLIKLGAAKDNKQRLKALMGLNPKDLIDSPQNGEPRTGLSMGDHQA
ITTLEWNISREAQDELAFNSHQNLARAYDEGFFDDLITPYKGLTRDNNLRPDTTLEKLAK
LKPVFGKKNAKPTMTAANSTPLTDGASCILLGTDEWAAAHGLKPLAYIVHQETAAVDFIG
KSGDTEGLLMAPAYAVPRMLERAGLTLQDFDFYEIHEAFASQVLSTLAAWEDEKFCEERL
GLDAPLGSIDRSKLNVNGSSLAAGHPFAATGGRILATAAKLLDQKGSGRALISICAAGGQ
GVTCILEK
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataaaaacaatcacccagatagccctgttgttgaagctactgttgttaaagct
actgatgctaaaagcacagatactgctgctgataaagccgcgactgatacgaaaaaagct
gacactaaggctacagactcaaaagtagcgagccctaaaaaagaaactccagctaacact
agcaaaagtacgcctgctaaaggcgatactgttgctaaagatggtgctgctaaagaaagc
aacgagaaagctaataacgacaaagacagcactgataaaaaagatgctgataaaaaggtc
gaagcgacaactgccaagaaaacaaccacggctgctaaaaaagccagtacaaccaagctt
agctcaggtcagcatcgtgtggctatcttaggtggtaaccgtatcccatttgcacgctca
aacggtagctacgctgatgttagcaatactgacatgctaacggctgcattagatggtctg
attgaacgttataatctacaagatgaaaaaattggtgaagtggttgctggtgcagtcatg
aaattaagccgcgacatcaacttaactcgtgaagcggccctaaacacggcgcttaaccca
cataccccaacttatgatatctcacaagcttgtggtactggcttgcaagcaacatttgcc
tccgccaataaaatcgcccttggtatcatcgattcagccattactggcggtgttgataca
acctctgatgctcctatcgcggtcggtgatggcttacgtaaagtcttgattaaattgggc
gccgctaaagacaacaaacaacgtctaaaagcactaatgggtctaaatccaaaagattta
atcgactcaccacaaaatggcgagccacgtactggtctatcaatgggcgatcatcaagcg
atcaccacgcttgaatggaacatcagccgtgaagcgcaagatgagcttgcttttaatagc
catcaaaacctagcacgtgcttatgacgaaggtttctttgatgatttaatcaccccatat
aaaggtctgactcgcgataacaacttgcgtccagacaccactttggaaaaactggccaag
ctaaagcctgtctttggcaaaaagaatgccaaaccaaccatgactgctgctaactctacc
ccactgactgatggcgcgtcttgcatcctattgggtactgacgagtgggctgcagcacat
ggcctaaaaccattggcttatatcgtccatcaagaaacagccgctgttgacttcatcggt
aaatctggtgatacagaaggtctactgatggcgcctgcttatgccgtaccgcgtatgctt
gagcgtgctggtctaactttacaagacttcgatttttatgaaattcatgaagcgtttgcc
tcacaagtgttatcaacccttgctgcatgggaagacgagaagttctgtgaagaacgccta
ggattagatgcgccactaggctcgattgatcgtagcaaactaaacgtgaatggttcttca
cttgctgcaggacatccatttgctgctactggcggtcgtatcctagcaactgctgccaaa
ttactggatcaaaaaggttcaggtcgtgcgcttatctctatctgcgcagcgggcggtcaa
ggtgttacttgtattctagagaagtaa

DBGET integrated database retrieval system