KEGG   Pseudomonas syringae CC1557: N018_11840Help
Entry
N018_11840        CDS       T03014                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:psyr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    N018_11840
Enzymes [BR:psyr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     N018_11840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2549149..2550075)
Genome map
AA seq 308 aa AA seqDB search
MSKIAVIGSNMVDLITYIERMPAQGETLEAPSFAMGCGGKGANQAAAAALLGADVLMLSK
VGDDAFADTTLANFQRLGIDTRFVERVPGVSSGVAPIFVQENSHNSILIVKGANAHLSPT
DIDRAEAQLRDCALIVLQLEIELATVYHAIAFAHRHAIPVLLNPAPALSGLSREHLAQLD
FLIPNESELALISGQPVTCAEEAAQAARQLVALGVRHVIVTLGEQGALYVGAEGEWQTPG
VKVKARDTTGAGDAFIGCFARHWSQDGNIRQAMHHAVAYSACSVTSLGTQSSYPDAPTFA
RFLNASAN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagattgcagtcatcggcagcaacatggtcgacctgatcacttacatcgaacgc
atgcccgcccagggagaaacgctcgaagcaccaagttttgccatggggtgcggcggcaaa
ggcgccaatcaggccgccgctgcggcgctgctgggcgcagacgtgctgatgctcagcaag
gtcggcgacgatgctttcgccgataccacgctggccaattttcaacggctgggcattgat
acgcgcttcgtcgaacgggtgccgggcgtgtcgagcggcgtggcgccgatcttcgttcag
gagaactcccacaacagcatcctcatcgtcaaaggcgccaatgcccatttgagcccgacc
gatatcgaccgcgccgaggcgcagttgcgcgattgcgctttgattgtgctgcaactggaa
atagagctggcgaccgtttaccacgccatcgccttcgctcaccggcatgccatcccggtg
ctgctcaatccggcccctgctttgtccggtctgagtcgcgagcacctggcgcagctggat
ttcctgatccccaacgagagcgagctagcactgatcagcggccagccggtgacgtgcgcc
gaggaggcggctcaggctgcacgccaattggtcgcgctgggcgtacgtcacgtcatcgtc
accctgggcgaacaaggggcgctgtacgtcggcgccgaaggcgagtggcagacgccaggg
gtcaaggttaaggcgcgtgacaccaccggtgccggtgacgccttcattggctgcttcgcc
cggcactggagccaggacggcaatatccgccaagccatgcaccacgctgtggcctactcc
gcctgctcggtcaccagcctcggcacgcaatcttcttatcccgatgcacccacgtttgcg
cgattcctcaatgcatcggccaactga

DBGET integrated database retrieval system