KEGG   Pseudomonas syringae CC1557: N018_13960Help
Entry
N018_13960        CDS       T03014                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psyr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    N018_13960
   00650 Butanoate metabolism
    N018_13960
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N018_13960
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    N018_13960
Enzymes [BR:psyr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     N018_13960
Amino acid related enzymes [BR:psyr01007]
 Aminotransferase (transaminase)
  Class III
   N018_13960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2969719..2971095
Genome map
AA seq 458 aa AA seqDB search
MSEAKLQSLHFADAPRIISGELPGPKTREALALSARTESMARGGGRMPIAMDRAFGATFK
DPDGNTYIDLSAGVGVSSVGRCHPKVVQAIHEQSAVLMHALEINSTRRTELAAKLSEIAP
EGLRGDCITFFTQSGSDALEAAIKFAKRITGRHQIIAFHGGYHGVWNASGSLTTGTAYRK
GFGAQMGGVIHAPYPYAYRFPFDTTHKSAEQIAGEYIDYLLNTPYTAADDVAAVIVEPVQ
GEGGYVPPSPEFLQLLRKACDRSGTLLIVDEVQSGAGRTGKMWAVEHSGVKPDMLTFGKG
IGSDLPMAGLIMRSDLAAKIPDGSMPNTFAANSLSAAVALTNISILKDPELDLLNRAHLL
GLEAQAHIRGFNSPLVGEVRGRGLMIGIELIEDPLTKAPLAGEKIGQLMGYLLNHGVLMI
PCGRYSNVMRVMPSLTISRELFFKALDIFGDALASLKA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagccaaactgcaatccctgcacttcgcggatgccccgcggattatctccggc
gaactgccaggccccaagacccgcgaagctctggcgctttcggcgcgtaccgagtccatg
gcgcgcggaggcggacgtatgccgatcgccatggaccgcgccttcggtgcgaccttcaaa
gacccggacggcaacacctacatcgacctgtccgccggcgtcggtgtcagcagcgtaggc
cgctgccaccccaaagtggtgcaggcgattcacgaacagtccgcagtgctgatgcacgcc
ctggaaattaacagcacccggcgtaccgagctggccgccaagctgtccgaaatcgcgccc
gaaggtttgcgtggcgactgcatcaccttcttcacgcaaagcggcagtgatgcgttggag
gcggcaatcaagttcgccaagcgcataaccgggcggcaccagatcatcgccttccacggc
ggctaccacggcgtgtggaacgcttcaggctcgctgaccaccggcacggcgtaccgcaag
ggctttggcgcgcagatggggggcgtgattcacgccccctacccttacgcctaccggttc
cccttcgacaccacccataaaagcgccgagcagatcgccggcgagtacatcgactacctg
ctgaacaccccgtacaccgccgccgatgatgtggcggcggtgattgtggaaccggtacag
ggcgaaggcggctacgtgccgccgtcgccggaattcctgcaattgctgcgcaaggcctgc
gaccgcagcggcacattgctgattgtcgatgaagtgcagtccggcgctggccgcaccggc
aaaatgtgggcggtcgaacattccggcgtgaagcccgacatgctcaccttcggcaaaggc
atcggcagcgacctgcccatggccggcctgatcatgcgctcggacctggcggcgaaaatc
cccgacggttccatgcccaatacgttcgccgccaactcgttgtcggctgcggtggcactg
accaacatcagcatcctgaaggatcctgagctcgacctgctcaaccgcgcccacctgctg
gggctggaggcacaggcgcatattcgcggtttcaacagcccgttggtcggtgaagtgcgc
gggcgcggcctgatgatcggcatcgaactgatcgaagacccgctcaccaaggctcccctg
gcgggcgaaaagatcggccagttaatgggctatctgctcaaccatggcgtgctgatgatt
ccctgcggccgctacagcaacgtgatgcgcgtgatgccctcgctaacgatctcccgcgaa
ctgtttttcaaggcactggacatcttcggcgatgccctggcgtctctcaaggcgtga

DBGET integrated database retrieval system