KEGG   Pseudomonas syringae CC1557: N018_21295Help
Entry
N018_21295        CDS       T03014                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psyr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    N018_21295
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    N018_21295
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    N018_21295
Enzymes [BR:psyr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     N018_21295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
4708037..4709608
Genome map
AA seq 523 aa AA seqDB search
MTDFNPDRRRIITGVAGATLLSILSPFARSAGVDYPFTLGVASGDPLPDGFVIWTRLAPK
VMTPSGDGGLNKPVEVRWKIASDAAMVHIVRTGQATAHPRLAHSVHVEVSGLQPGRPYWY
QFESLGAQSAVGQACTAPPASAMVSARFGFVSCSHWEAGYFSAYRHLAAERPDLVFFLGD
YIYEMNVSAENPRFPRHHATPDPMDLAGYRNRYAQYKTDPDLQALHACAPSVATWDDHEV
QNDYAAQWSQDPGVPVDSFLRRRTAAYQAFYEHMPLRASSLPKGQEMRIYRNLDYGRLAR
FHVLDGRQYRSEQPCIQANGSRRGHVAPSDCPDLHDPKRTMLGWEQEAWLDRSFAESPGQ
WNVIAQDLLVAPLEQRDLKTQALGHWTDGWDGYMTTRERVLASLQRHQTRNPVFWGGDIH
SFWTTDLHADAGNPDSAIVATEFVGTSVTSSGPPFDAFNSILGLNPHVKFFDSRQRGYVS
VDLSEQQMLTRFQVVSEVLDPAASVSTLKQFAVEAGKTGAVPG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttcaacccggaccgtcgacgcatcattactggagtagccggtgcaacgttg
ctgtcgatcctcagcccgtttgcgcgcagcgcgggggtcgattatccattcacgctcggc
gtggcgtctggcgatccgttgccggacggcttcgtgatatggacacgtctggcaccaaaa
gtgatgactccctcgggtgatggcggtctgaacaaacctgttgaagtgcgttggaagatc
gccagcgatgcggccatggttcacatagtccgcacaggacaggccaccgcccacccgcga
cttgcccattcagtgcatgtcgaagtgagcggtttgcagcccggacgtccgtattggtat
cagttcgagagcctgggggcgcaaagcgctgtcgggcaggcgtgtactgcaccgccggca
agcgccatggtctcggcgcggttcggcttcgtgtcgtgttcgcactgggaggcaggatac
ttcagcgcctatcgacacctggcggcggagcgcccggatctggtgttctttcttggcgac
tacatctatgagatgaacgtatccgcggaaaaccctcggttcccgcgtcaccacgctaca
cctgaccccatggacctggcgggctatcgcaatcgatacgcgcagtacaagaccgacccc
gacctgcaagctttgcatgcttgcgcgccgagcgtcgccacgtgggacgatcatgaagtg
caaaacgattacgccgctcagtggtcacaggaccccggcgtgcctgtggacagttttctg
cgccgcaggaccgccgcttatcaggcgttttacgaacacatgccgttgcgcgccagcagc
ctgcccaaaggacaggaaatgcgtatctaccgcaacctcgactacgggcgtctggctcgt
tttcacgtgctggacggtcgacagtaccgctccgagcaaccctgcatccaggccaacggc
agccgtcgaggtcacgtcgcgcccagcgactgtccggatctgcatgacccgaaacgcacc
atgctcggctgggaacaggaagcctggctggaccgcagcttcgccgagtctcccgggcag
tggaatgtcattgcccaggatttgctggtcgcgccactggaacagcgcgatctcaagacc
caggcgctgggccactggaccgacggctgggacggctacatgaccacccgcgagcgcgtg
ctggcctccctgcaacgccaccagacccgcaacccggtgttctggggtggcgatatccat
tcgttctggaccaccgacctgcacgccgacgcaggtaatccggattcagccatcgtcgcc
accgagttcgtcggcacttcggtaacctccagcggaccaccgttcgacgctttcaacagc
attctgggcctcaatccacatgtgaagttcttcgatagccgtcagcgtggctatgtgtcc
gtggacctgagcgagcagcaaatgctgactcgcttccaggttgtttcggaggtgcttgac
cctgccgccagcgtgtcgacgctcaagcaatttgcagtggaggctggcaagaccggggct
gtacctggctag

DBGET integrated database retrieval system