KEGG   Pseudomonas syringae CC1557: N018_21480Help
Entry
N018_21480        CDS       T03014                                 

Definition
penicillin-binding protein 1B
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:psyr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N018_21480
Enzymes [BR:psyr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     N018_21480
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     N018_21480
Glycosyltransferases [BR:psyr01003]
 Polysaccharide
  Bacterial polysaccharide
   N018_21480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(4748858..4751179)
Genome map
AA seq 773 aa AA seqDB search
MTRSRTSRSPKKQPPRSLHKWLGWALKLGIVGLVLLGGLAIYLDAIVQEKFSGKRWTIPA
KVYARPLELFVGQKLSRDDFLIELDALGYRRESVANGPGAAAVNGNTVDLNTRGFQFYEG
TDAAQQVRVRFSGDYVADLSSGNGAKLAVARLEPLLIGGLYPKNLEDRILIKLDQAPPYL
LDGLVAVEDRDFYHHFGVSPKSIARAIWVNTSQGQMRQGGSTLTQQLVKNFYLTNERSLT
RKLTEAMMAVLLEIHYSKQEILEAYLNEVFVGQDGQRAVHGFGLASQYFFSQPLSELKIH
QVAMLVGLVKGPSFYNPRRNPERALERRNLVLDLFEQQGVATPEVVAAAKKLPLGVTKTG
TLADSSFPAFLDLVKRQLREDYRDEDLTEEGLRIFTSFDPILQMKSQAAIDDTFKKLAGR
KGVDEVEAGMVVTNPETGEVQALIGGREAGFSGFNRAIDAVRPIGSLVKPAIYLTALERP
SQYTLTSWIADELFQVKGADGQIWKPQNYDRKSHGNIFLYQGLAHSYNLSTAKLGLDLGI
PNVFKTLAKLGVTREWPAYPSMLLGAGGLSPMEVATMYQTIASGGFNTPMRGIRSVLTAE
GEPLKRYPFKIEQRFDPGAIYLVQNAMQRVMREGTGKSVYNVLPSSLNLAGKTGTSNDSR
DSWFAGFSQDLLAVVWMGRDDNGKTPFTGATGALQVWTSFMRKADPLPLDMAMPDNVVLA
WVDAQTGQGSDASCPNAVQMPYIRGSEPQPGATCGGAPAPATEVMDWVKGWLN
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgactcgatcccgcacctctcgttcccccaaaaagcaacctccccgcagcctgcacaag
tggctgggctgggcgttgaagcttggtatcgtcggcctggttctgctgggcggcctggcg
atttatctcgatgccattgttcaggaaaaattctccggcaagcgctggaccattccggcc
aaggtctacgctcggccgctggagctgttcgtcgggcaaaaactcagccgcgatgacttc
ctcatcgagctggacgctctgggctatcgccgcgaaagcgtggcgaacgggcccggcgcc
gcagcggtgaacggcaataccgtcgatctcaatacgcgcggctttcagttctacgaaggc
actgacgcagcgcagcaggttcgcgtgcgcttttctggtgactatgtagccgacctgtcc
tcgggcaacggcgccaagcttgcagtcgcacggcttgagcctctgctgatcggcgggctg
tatccgaaaaatctcgaagaccgcattctgatcaagctcgatcaggcaccgccgtatctg
ctcgacgggctggtggcggtcgaggaccgggatttctatcaccactttggtgtgtcgccc
aaatccatcgcccgggctatctgggtcaacacctcccaagggcagatgcgccagggcggc
agtacgctgactcaacagttggtcaagaacttctacctgaccaacgagcgcagcctgacc
cgcaaactgaccgaagccatgatggctgtcttgctggagattcattacagcaagcaggaa
atcctcgaagcgtatctcaacgaggtatttgtcggtcaggacggccagcgtgctgtccac
ggtttcggcctggccagtcagtatttcttcagtcagccgctgtccgagctgaaaatccat
caggtggcgatgctggtcggtctggtcaaagggccgtctttctataacccgcgtcgcaat
cccgagcgcgcactggaacgccgtaatctggtgctcgacttatttgagcagcaaggtgtt
gccacgccggaagtggtcgccgctgcgaaaaaactgccactgggtgtgaccaaaaccggc
acgcttgccgacagttctttcccggcgtttcttgatctggtcaaacgtcagttacgtgaa
gactatcgtgatgaagacttgaccgaagagggcctgcggatcttcaccagtttcgatccg
atcctgcagatgaaatcccaggccgccatagacgatacgttcaaaaagctcgccggacgc
aagggtgttgatgaagtagaagcgggcatggtcgtcaccaatccggagaccggtgaagtg
caggcgctgatcggtggacgtgaagccgggttctcgggtttcaaccgggcgatcgacgcg
gtgcggccgattggctcgctggtcaagccggctatttatctgacggcgctggagcgcccg
agccaatacacgctcaccagttggatcgccgacgagctgttccaggtcaagggcgccgac
ggtcagatctggaagccgcagaattacgatcgcaagtcccacggcaatatctttctgtat
caggggctggcgcattcctacaacctgtcgaccgccaagctgggccttgatctgggtatt
ccgaatgtgttcaaaacgctggccaagctgggcgttacccgcgaatggcctgcttatcct
tcgatgttgctgggggcaggcggcttgagtccgatggaggtcgccaccatgtaccagacc
atcgccagtggcgggttcaatacgccgatgcgcggtatccgcagcgtgttgaccgctgaa
ggtgaaccgctcaagcgctatccgttcaagatcgagcagcgctttgatccaggtgcgatt
tatctggtacagaatgcgatgcagcgcgttatgcgtgaaggtacgggcaaatctgtttac
aacgtcttgccgagctcgttgaacctggcgggcaagaccggcaccagtaacgattcccgc
gacagctggtttgccggtttcagtcaggatctgctggcagtggtctggatgggccgcgac
gataacggcaagacaccgttcaccggtgctaccggggccttgcaggtctggacgagcttc
atgcgcaaggctgatccgctgccgctggacatggcaatgccggacaacgtcgtgctggcg
tgggtggatgcgcagaccggccagggttcggacgccagctgcccgaatgcagtgcagatg
ccgtatattcgcggcagtgagccccagcccggcgcgacatgcggcggcgctccagcacct
gcgactgaggtgatggactgggtcaagggttggttgaactag

DBGET integrated database retrieval system