KEGG   Pseudomonas syringae CC1557: N018_24535Help
Entry
N018_24535        CDS       T03014                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psyr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    N018_24535
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N018_24535
   00310 Lysine degradation
    N018_24535
Enzymes [BR:psyr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     N018_24535
    2.6.1.48  5-aminovalerate transaminase
     N018_24535
Amino acid related enzymes [BR:psyr01007]
 Aminotransferase (transaminase)
  Class III
   N018_24535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(5460472..5461752)
Genome map
AA seq 426 aa AA seqDB search
MSKTNDSLMQRRHAAVPRGVGQIHPIFAASAKNATVTDVEGREFIDFAGGIAVLNTGHLH
PKIVAAVQEQLTKLTHTCFQVLAYEPYVELCEKVNAKVPGDFEKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPCELHGVS
VDDSIASIERIFKNDAEPKDIAAIIIEPVQGEGGFYVAPKAFMKRLRELCDKHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPVACAAALAVLDIFEEEHLLERCKALGEHLVTSLKAMQAKYPVIGEVRALGAMIAVEL
FEDGDSHKPNAAAVAQVVAKARDKGLILLSCGTYGNVLRVLVPLTAEDELLNRGLAILDE
CFAEIV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagactaacgactccctgatgcaacgccgccatgctgccgtcccgcgcggcgtt
gggcagatccacccgatcttcgctgcttcggcgaagaacgcgactgtgaccgacgtagaa
ggtcgtgaattcattgacttcgccggcggcattgctgtgctgaacactggccacctgcac
ccgaaaatcgttgcagcggtgcaagagcagctgaccaagctgacccacacctgcttccag
gtgctggcttacgagccatacgtcgagctgtgcgaaaaggtcaacgccaaggtcccgggt
gatttcgagaagaaaaccctgctggtgaccaccggttccgaagcggtggaaaacgccgtg
aagatcgcccgtgcggccactggccgtgccggtgtgattgcattcaccggcgcttaccac
ggccggaccatgatgaccctcggtctgactggcaaggtggtgccttactcggctggcatg
ggcttgatgccgggcggtatcttccgcgcgctgtacccatgcgagctgcatggcgtgagc
gttgacgattccatcgccagcatcgagcgcatcttcaagaacgatgccgagccaaaggac
atcgctgcaatcatcatcgagccggtgcagggcgagggtggtttctacgtggcgccgaag
gcgttcatgaagcgtctgcgcgagctgtgcgacaagcacggcatcctgctgatcgctgat
gaagtgcagactggcgctggccgtactggcaccttcttcgccatggagcagatgggcgtt
gctgccgacctgaccacgtttgccaagtccattgctggcggtttcccgctggcgggcgta
tgcggcaaggccgagtacatggacgccatcgcacccggtggcctgggcggcacctatgcc
ggcagcccggtagcctgtgcggcggcactggcggttctggatatctttgaagaagagcat
ctgctggagcgctgcaaggcactcggcgaacacctggtgacgtcgctcaaggcgatgcag
gccaagtacccggtcatcggtgaagtgcgtgcgctgggcgcgatgatcgctgtcgagctg
ttcgaagacggcgactcgcacaagcctaacgctgcagcggtcgcgcaggtcgtggcgaaa
gcgcgtgacaaggggctgatcctgctgtcgtgcggcacttacggcaacgtgttgcgggtg
cttgtaccgctgaccgccgaagatgaattgctgaaccgtggtctggcgattctcgacgaa
tgttttgctgaaatcgtctga

DBGET integrated database retrieval system